Overview

  • Product name

  • Description

    Rabbit polyclonal to STIP1/STI1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Cow, Human
    Predicted to work with: Mouse, Rat, Cynomolgus monkey, Chinese hamster
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human STIP1/STI1 aa 1-169. Two N-terminal tags. (Expressed in E.coli).
    Sequence:

    MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAK KGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLK HEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDP TYRELIEQLRNKPSDLGTK


    Database link: P31948

  • Positive control

    • IHC-P: Human cerebrum, liver, kidney, stomach, prostate cancer and colorectal cancer tissue. WB: Recombinant human STIP1/STI1 protein; Human lung lysate; Jurkat cell lysate; Cow testis and spleen lysates.
  • General notes

     This product was previously labelled as STIP1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab233196 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 63 kDa.

Target

  • Function

    Mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).
  • Sequence similarities

    Contains 2 STI1 domains.
    Contains 9 TPR repeats.
  • Domain

    The TPR 1 repeat interacts with the C-terminal of HSC70. The TPR 4, 5 and 6 repeats (also called TPR2A domain) and TPR 7, 8 and 9 repeats (also called TPR2B domain) interact with HSP90.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Epididymis secretory sperm binding protein Li 94n antibody
    • HEL S 94n antibody
    • Hop antibody
    • Hsc70/Hsp90 organizing protein antibody
    • Hsc70/Hsp90-organizing protein antibody
    • IEF SSP 3521 antibody
    • NY REN 11 antigen antibody
    • P60 antibody
    • Renal carcinoma antigen NY-REN-11 antibody
    • STI1 antibody
    • STI1L antibody
    • STIP1 antibody
    • STIP1_HUMAN antibody
    • Stress induced phosphoprotein 1 antibody
    • Stress-induced-phosphoprotein 1 antibody
    • Transformation sensitive protein IEF SSP 3521 antibody
    • Transformation-sensitive protein IEF SSP 3521 antibody
    see all

Images

  • Anti-STIP1/STI1 antibody (ab233196) at 2 µg/ml + Recombinant human STIP1/STI1 protein

    Predicted band size: 63 kDa

  • All lanes : Anti-STIP1/STI1 antibody (ab233196) at 1 µg

    Lane 1 : Human lung lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate
    Lane 3 : Cow testis lysate
    Lane 4 : Cow spleen lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 63 kDa

  • Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for STIP1/STI1 using ab233196 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for STIP1/STI1 using ab233196 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for STIP1/STI1 using ab233196 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for STIP1/STI1 using ab233196 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for STIP1/STI1 using ab233196 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for STIP1/STI1 using ab233196 at 20 µg/mL in immunohistochemical analysis. DAB staining.

References

ab233196 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233196.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up