Overview

  • Product name

  • Description

    Rabbit polyclonal to STK35
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human STK35 aa 1-200.
    Sequence:

    MGHQESPLARAPAGGAAYVKRLCKGLSWREHVESHGSLGAQASPASAAAA EGSATRRARAATSRAARSRRQPGPGADHPQAGAPGGKRAARKWRCAGQVT IQGPAPPRPRAGRRDEAGGARAAPLLLPPPPAAMETGKDGARRGTQSPER KRRSPVPRAPSTKLRPAAAARAMDPVAAEAPGEAFLARRRPEGGGGSARP


    Database link: Q8TDR2

  • Positive control

    • WB: Mouse heart, liver and brain tissue lysate. IHC-P: Human skeletal muscle tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab237517 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Tissue specificity

    Expressed in testis.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated.
  • Cellular localization

    Nucleus. Nucleus > nucleolus. Cytoplasm. When associated with PDLIM1, it is mostly found in cytoplasm, localized to actin stress fibers (PubMed:11973348). However, PubMed:19756140 detected STK35 only in the nucleus, and the presence of PDLIM1 had no influence on its location.
  • Information by UniProt
  • Database links

  • Alternative names

    • CLIK-1 antibody
    • Clik1 antibody
    • CLP 36 interacting kinase antibody
    • CLP-36-interacting kinase 1 antibody
    • EC 2.7.1.37 antibody
    • PDLIM1 interacting kinase antibody
    • PDLIM1-interacting kinase 1 antibody
    • Serine threonine kinase 35 long form antibody
    • Serine/threonine kinase 35 antibody
    • Serine/threonine protein kinase 35 antibody
    • Serine/threonine-protein kinase 35 antibody
    • Serine/threonine-protein kinase 35 L1 antibody
    • STK35 antibody
    • STK35_HUMAN antibody
    • STK35L1 antibody
    see all

Images

  • All lanes : Anti-STK35 antibody (ab237517) at 1/500 dilution

    Lane 1 : Mouse heart tissue lysate
    Lane 2 : Mouse liver tissue lysate
    Lane 3 : Mouse brain tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Paraffin-embedded human skeletal muscle tissue stained for STK35 using ab237517 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for STK35 (Green) at 1/100 dilution in ICC/IF, followed by an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

References

ab237517 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237517.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up