Overview

  • Product name

    Anti-STK38 antibody
  • Description

    Rabbit polyclonal to STK38
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human STK38 aa 1-200.
    Sequence:

    MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEK VMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAF GEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDILVEADSLWVV KMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAI


    Database link: Q15208

  • Positive control

    • IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238340 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Negative regulator of MAP3K1/2 signaling. Converts MAP3K2 from its phosphorylated form to its nonphosphorylated form and inhibits autophosphorylation of MAP3K2.
  • Tissue specificity

    Ubiquitously expressed with highest levels observed in peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    ISGylated.
  • Cellular localization

    Nucleus. Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • NDR 1 antibody
    • NDR antibody
    • Ndr Ser/Thr kinase-like protein antibody
    • NDR1 antibody
    • NDR1 protein kinase antibody
    • Nuclear Dbf2 related kinase 1 antibody
    • nuclear Dbf2-related 1 antibody
    • Nuclear Dbf2-related kinase 1 antibody
    • Nuclear Dbf2-related protein antibody
    • Serine/threonine protein kinase 38 antibody
    • Serine/threonine-protein kinase 38 antibody
    • STK 38 antibody
    • STK38 antibody
    • STK38_HUMAN antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for STK38 using ab238340 at 1/100 dilution in immunohistochemical analysis.

References

ab238340 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238340.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up