Overview

  • Product name

  • Description

    Rabbit polyclonal to STK38L/Ndr2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human STK38L/Ndr2 aa 212-464.
    Sequence:

    RDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQ NMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGV IMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKDLILRF CIDSENRIGNSGVEEIKGHPFFEGVDWEHIRERPAAIPIEIKSIDDTSNF DDFPESDILQPVPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKA GKL


    Database link: Q9Y2H1

  • Positive control

    • WB: A-375, HepG2, A549 and HCT 116 whole cell lysates. IHC-P: Human breast cancer, ovarian cancer and thymus tissues.
  • General notes

     This product was previously labelled as STK38L

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235304 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 54 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    Involved in the regulation of structural processes in differentiating and mature neuronal cells.
  • Tissue specificity

    Ubiquitously expressed with highest levels observed in the thymus.
  • Sequence similarities

    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton. Associated with the actin cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA0965 antibody
    • NDR2 antibody
    • NDR2 protein kinase antibody
    • nuclear Dbf2 related 2 antibody
    • Nuclear Dbf2 related kinase 2 antibody
    • Nuclear Dbf2-related kinase 2 antibody
    • Serine/threonine protein kinase 38 like antibody
    • Serine/threonine-protein kinase 38-like antibody
    • ST38L_HUMAN antibody
    • Stk38l antibody
    see all

Images

  • All lanes : Anti-STK38L/Ndr2 antibody (ab235304) at 1/500 dilution

    Lane 1 : A-375 (human malignant melanoma cell line) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 3 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 4 : HCT 116 (human colorectal carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 54 kDa

  • Paraffin-embedded human breast cancer tissue stained for STK38L/Ndr2 using ab235304 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human ovarian cancer tissue stained for STK38L/Ndr2 using ab235304 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human thymus tissue stained for STK38L/Ndr2 using ab235304 at 1/100 dilution in immunohistochemical analysis.

References

ab235304 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235304.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up