Overview

  • Product name

  • Description

    Rabbit polyclonal to STK3/MST-2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human STK3/MST-2 aa 323-450.
    Sequence:

    SHTMVKTSVESVGTMRATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDE EEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPMSK NVFPDNWKVPQDGDFDFLKNLSLEELQM


    Database link: Q13188

  • Positive control

    • WB: HeLa, A-375, U-87 MG and NIH/3T3 whole cell lysates. IHC-P: Human liver and small intestine tissue. ICC/IF: HeLa cells.
  • General notes

    Previously labelled as STK3. 

Properties

Applications

Our Abpromise guarantee covers the use of ab236300 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 56 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Stress-activated, pro-apoptotic kinase which, following caspase-cleavage, enters the nucleus and induces chromatin condensation followed by internucleosomal DNA fragmentation. Key component of the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. MST1/MST2 are required to repress proliferation of mature hepatocytes, to prevent activation of facultative adult liver stem cells (oval cells), and to inhibit tumor formation. Phosphorylates NKX2-1.
  • Tissue specificity

    Expressed at high levels in adult kidney, skeletal and placenta tissues and at very low levels in adult heart, lung and brain tissues.
  • Sequence similarities

    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
    Contains 1 protein kinase domain.
    Contains 1 SARAH domain.
  • Cellular localization

    Cytoplasm. Nucleus. The caspase-cleaved form cycles between nucleus and cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 0610042I06Rik antibody
    • EC 2.7.11.1 antibody
    • FLJ90748 antibody
    • KB 1458E12.1 antibody
    • Kinase responsive to stress 1 antibody
    • KRS1 antibody
    • Mammalian STE20 like protein kinase 2 antibody
    • Mammalian STE20-like protein kinase 2 antibody
    • Mammalian sterile 20-like 2 antibody
    • Mess1 antibody
    • MST antibody
    • MST-2 antibody
    • MST2 antibody
    • Mst3 antibody
    • Serine/threonine kinase 3 (STE20 homolog, yeast) antibody
    • Serine/threonine kinase 3 (Ste20, yeast homolog) antibody
    • Serine/threonine kinase 3 antibody
    • Serine/threonine protein kinase 3 antibody
    • Serine/threonine protein kinase Krs1 antibody
    • Serine/threonine-protein kinase 3 antibody
    • Serine/threonine-protein kinase Krs-1 antibody
    • STE20 like kinase MST2 antibody
    • STE20-like kinase MST2 antibody
    • Stk3 antibody
    • STK3_HUMAN antibody
    • wu:fc19e11 antibody
    • zgc:55383 antibody
    see all

Images

  • All lanes : Anti-STK3/MST-2 antibody (ab236300) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 56 kDa

  • Paraffin-embedded human small intestine tissue stained for STK3/MST-2 using ab236300 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for STK3/MST-2 (green) using ab236300 at 1/141 dilution in ICC/IF. The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the antibody overnight at 4°C. Secondary antibody is an Alexa-Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

  • All lanes : Anti-STK3/MST-2 antibody (ab236300) at 1/500 dilution

    Lane 1 : A-375 (human malignant melanoma cell line) whole cell lysate
    Lane 2 : U-87 MG (human glioblastoma-astrocytoma epithelial cell line) whole cell lysate
    Lane 3 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 56 kDa

  • Paraffin-embedded human liver tissue stained for STK3/MST-2 using ab236300 at 1/100 dilution in immunohistochemical analysis.

References

ab236300 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236300.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up