Overview

  • Product name

    Anti-Stomatin antibody - C-terminal
    See all Stomatin primary antibodies
  • Description

    Rabbit polyclonal to Stomatin - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human Stomatin aa 55-288 (C terminal).
    Sequence:

    KIIKEYERAIIFRLGRILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIP PQEILTKDSVTISVDGVVYYRVQNATLAVANITNADSATRLLAQTTLRNV LGTKNLSQILSDREEIAHNMQSTLDDATDAWGIKVERVEIKDVKLPVQLQ RAMAAEAEASREARAKVIAAEGEMNASRALKEASMVITESPAALQLRYLQ TLTTIAAEKNSTIVFPLPIDMLQGIIGAKHSHLG


    Database link: P27105

  • Positive control

    • Mouse liver, Mouse spleen, Mouse heart and Rat liver tissue lysates; HeLa cells.
  • General notes

    Previously labelled as STOM. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab202135 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 32 kDa.
ICC/IF Use at an assay dependent concentration.

Target

  • Function

    Thought to regulate cation conductance. May regulate ACCN1 and ACCN3 gating.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the band 7/mec-2 family.
  • Cellular localization

    Cell membrane. Cell membrane. Melanosome. Exposed on the cytoplasmic surface of the membrane. Associated with lipid rafts. Concentrates preferentially in plasma membrane protrusions and in a juxta-nuclear region which may represent Golgi-derived vesicles. Colocalizes with actin. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt
  • Database links

  • Alternative names

    • BND7 antibody
    • EPB7 antibody
    • EPB72 antibody
    • Erythrocyte band 7 integral membrane protein antibody
    • Erythrocyte membrane protein band 7.2 (stomatin) antibody
    • Erythrocyte surface protein band 7.2 antibody
    • Protein 7.2b antibody
    • STOM antibody
    • STOM_HUMAN antibody
    • Stomatin antibody
    see all

Images

  • Immunofluorescent analysis of HeLa cells labeling Stomatin with ab202135 at dilution 1:50-1:200. DAPI was used for nuclear staining (Blue).

  • All lanes : Anti-Stomatin antibody - C-terminal (ab202135) at 1/500 dilution

    Lane 1 : Mouse liver tissue lysate
    Lane 2 : Mouse spleen tissue lysate
    Lane 3 : Mouse heart tissue lysate
    Lane 4 : Rat liver tissue lysate

    Predicted band size: 32 kDa

References

ab202135 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (HeLa cells)
Gel Running Conditions
Reduced Denaturing (4-12)
Loading amount
10 µg
Treatment
siRNA transfection (72h)
Specification
HeLa cells
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 21°C

Abcam user community

Verified customer

Submitted Nov 09 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up