Overview

  • Product name

  • Description

    Rabbit polyclonal to STRAD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse, Chicken, Cow, Macaque monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human STRAD aa 25-210.
    Sequence:

    RDLELFGEQPPGDTRRKTNDASSESIASFSKQEVMSSFLPEGGCYELLTV IGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKL FNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAY ILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVY


    Database link: Q7RTN6

  • Positive control

    • WB: Rat heart tissue lysate. IHC-P: Human brain and kidney tissue.
  • General notes

     This product was previously labelled as LYK5

     

Properties

Applications

Our Abpromise guarantee covers the use of ab230118 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 48 kDa.

Target

Images

  • Anti-STRAD antibody (ab230118) at 1/1000 dilution + Rat heart tissue lysate

    Secondary
    Goat anti-rabbit IgG at 1/10000 dilution

    Predicted band size: 48 kDa
    Observed band size: 48 kDa

  • Paraffin-embedded human brain tissue stained for STRAD using ab230118 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for STRAD using ab230118 at 1/100 dilution in immunohistochemical analysis.

References

ab230118 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230118.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up