Anti-Streptococcal Pyrogenic Exotoxin B antibody (ab225941)

Overview

  • Product name
    Anti-Streptococcal Pyrogenic Exotoxin B antibody
    See all Streptococcal Pyrogenic Exotoxin B primary antibodies
  • Description
    Rabbit polyclonal to Streptococcal Pyrogenic Exotoxin B
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity

    Predicted to work with: Streptococcus pyogenes
  • Immunogen

    Recombinant full length protein corresponding to Streptococcus pyogenes Streptococcal Pyrogenic Exotoxin B aa 146-398.
    Sequence:

    QPVVKSLLDSKGIHYNQGNPYNLLTPVIEKVKPGEQSFVGQHAATGCVAT ATAQIMKYHNYPNKGLKDYTYTLSSNNPYFNHPKNLFAAISTRQYNWNNI LPTYSGRESNVQKMAISELMADVGISVDMDYGPSSGSAGSSRVQRALKEN FGYNQSVHQINRSDFSKQDWESQIDKELSQNQPVYYQGVGKVGGHAFVID GADGRNFYHVNWGWGGVSDGFFRLDALNPSALGTGGGAGGFNGYQSAVVG IKP


    Database link: Q48R29

  • Positive control
    • WB: Recombinant Streptococcus pyogenes serotype M28 Streptopain protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab225941 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 44 kDa (predicted molecular weight: 44 kDa).

Target

Images

  • All lanes : Anti-Streptococcal Pyrogenic Exotoxin B antibody (ab225941) at 1/500 dilution

    Lane 1 : Recombinant Streptococcus pyogenes serotype M28 Streptopain protein at 0.08 µg
    Lane 2 : Recombinant Streptococcus pyogenes serotype M28 Streptopain protein at 0.04 µg
    Lane 3 : Recombinant Streptococcus pyogenes serotype M28 Streptopain protein at 0.02 µg
    Lane 4 : Recombinant Streptococcus pyogenes serotype M28 Streptopain protein at 0.01 µg

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 44 kDa
    Observed band size: 44 kDa

References

ab225941 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225941.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up