Overview

  • Product name

  • Description

    Rabbit polyclonal to STX11
  • Host species

    Rabbit
  • Specificity

    ab216046 detects endogenous level of total STX11 protein.
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Fusion protein corresponding to Human STX11 aa 1-287. Full length fusion protein: The identity of the protein fusion partner is GST
    Sequence:

    MKDRLAELLDLSKQYDQQFPDGDDEFDSPHEDIVFETDHILESLYRDIRD IQDENQLLVADVKRLGKQNARFLTSMRRLSSIKRDTNSIAKAIKARGEVI HCKLRAMKELSEAAEAQHGPHSAVARISRAQYNALTLTFQRAMHDYNQAE MKQRDNCKIRIQRQLEIMGKEVSGDQIEDMFEQGKWDVFSENLLADVKGA RAALNEIESRHRELLRLESRIRDVHELFLQMAVLVEKQADTLNVIELNVQ KTVDYTGQAKAQVRKAVQYEEKNPCRTLCCFCCPCLK


    Database link: O7555

  • Positive control

    • Mouse lung tissue lysate. Human thyroid cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab216046 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/400 - 1/2000. Predicted molecular weight: 33 kDa.
IHC-P 1/25 - 1/100. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.

Target

  • Function

    SNARE that acts to regulate protein transport between late endosomes and the trans-Golgi network.
  • Involvement in disease

    Defects in STX11 are the cause of hemophagocytic lymphohistiocytosis familial type 4 (FHL4) [MIM:603552]; also known as HPLH4. Familial hemophagocytic lymphohistiocytosis (FHL) is a genetically heterogeneous, rare autosomal recessive disorder. It is characterized by immune dysregulation with hypercytokinemia and defective natural killer cell function. The clinical features of the disease include fever, hepatosplenomegaly, cytopenia, hypertriglyceridemia, hypofibrinogenemia, and neurological abnormalities ranging from irritability and hypotonia to seizures, cranial nerve deficits, and ataxia. Hemophagocytosis is a prominent feature of the disease, and a non-malignant infiltration of macrophages and activated T lymphocytes in lymph nodes, spleen, and other organs is also found.
  • Sequence similarities

    Belongs to the syntaxin family.
    Contains 1 t-SNARE coiled-coil homology domain.
  • Cellular localization

    Membrane. Golgi apparatus > trans-Golgi network membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • FHL4 antibody
    • HLH4 antibody
    • HPLH4 antibody
    • Stx11 antibody
    • STX11_HUMAN antibody
    • Syntaxin 11 antibody
    • Syntaxin-11 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human thyroid cancer tissue tissue labeling STX11 using ab216046 at a 1/30 dilution.

  • Anti-STX11 antibody (ab216046) at 1/400 dilution + mouse lung tissue lysate at 40 µg

    Predicted band size: 33 kDa



    8% SDS-PAGE

References

ab216046 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216046.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up