Overview

  • Product name

  • Description

    Rabbit polyclonal to STX17
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Immunogen

    Recombinant fragment corresponding to Human STX17 aa 12-155.
    Sequence:

    RLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRT VQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLE SVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQ


    Database link: P56962

  • Positive control

    • IHC: Human prostate, endometrium, duodenum and skin tissue. WB: A431 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab224042 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 33 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Implicated in vesicle trafficking to lysosomes. Could be involved in processes related to cell division.
  • Sequence similarities

    Belongs to the syntaxin family.
    Contains 1 t-SNARE coiled-coil homology domain.
  • Cellular localization

    Membrane. Appears to be associated with a membrane compartment, perhaps a subset of the ER such as exit or entrance sites.
  • Information by UniProt
  • Alternative names

    • FLJ20651 antibody
    • MGC102796 antibody
    • MGC126613 antibody
    • MGC126615 antibody
    • Stx17 antibody
    • STX17_HUMAN antibody
    • Syntaxin 17 antibody
    • Syntaxin-17 antibody
    see all

Images

  • Paraffin-embedded human prostate tissue stained for STX17 using ab224042 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrium tissue stained for STX17 using ab224042 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human duodenum stained for STX17 using ab224042 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skin tissue stained for STX17 using ab224042 at 1/200 dilution in immunohistochemical analysis.

  • Anti-STX17 antibody (ab224042) at 1/250 dilution + A431 (human epidermoid carcinoma cell line) cell lysate

    Predicted band size: 33 kDa

References

ab224042 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224042.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up