Overview

  • Product name

    Anti-Styk1/NOK antibody
  • Description

    Rabbit polyclonal to Styk1/NOK
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Styk1/NOK aa 59-192.
    Sequence:

    SGPQGIAPVPPPRDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQV PREQLSEVLEQICSGSCGPIFRANMNTGDPSKPKSVILKALKEPAGLHEV QDFLGRIQFHQYLGKHKNLVQLEGCCTEKLPLYM


    Database link: Q6J9G0

  • Positive control

    • ICC/IF: RT-4 cells.
  • General notes

     This product was previously labelled as Styk1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab220262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 2 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

  • Function

    Probable tyrosine protein-kinase, which has strong transforming capabilities on a variety of cell lines. When overexpressed, it can also induce tumor cell invasion as well as metastasis in distant organs. May act by activating both MAP kinase and phosphatidylinositol 3'-kinases (PI3K) pathways.
  • Tissue specificity

    Widely expressed. Highly expressed in brain, placenta and prostate. Expressed in tumor cells such as hepatoma cells LO2, cervix carcinoma cells HeLa, ovary cancer cells Ho8910 and chronic myelogenous leukemia cells K562, but not in other tumor cells such as epidermoid carcinoma (A431). Undetectable in most normal lung tissues, widely expressed in lung cancers.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family.
    Contains 1 protein kinase domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp761P1010 antibody
    • NOK antibody
    • Novel oncogene with kinase domain antibody
    • Protein kinase STYK1 antibody
    • Protein PK unique antibody
    • Protein PK-unique antibody
    • Serine/threonine/tyrosine kinase 1 antibody
    • Styk 1 antibody
    • STYK1 antibody
    • STYK1_HUMAN antibody
    • SuRTK 106 antibody
    • SuRTK106 antibody
    • Tyrosine protein kinase STYK1 antibody
    • Tyrosine-protein kinase STYK1 antibody
    see all

Images

  • Immunofluorescent analysis of RT-4 cells (PFA-fixed/Triton X-100 permeabilized) labeling Styk1/NOK with ab220262 at 4 μg/mL (green).

References

ab220262 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up