Overview

  • Product name

  • Description

    Rabbit polyclonal to SUCLG1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Pig
  • Immunogen

    Recombinant fragment corresponding to Human SUCLG1 aa 115-186.
    Sequence:

    ASVIYVPPPFAAAAINEAIEAEIPLVVCITEGIPQQDMVRVKHKLLRQEK TRLIGPNCPGVINPGECKIGIM


    Database link: P53597

  • Positive control

    • RT-4 and U-251 MG lysates; Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab204432 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 36 kDa.

Target

  • Function

    Catalyzes the ATP- or GTP-dependent ligation of succinate and CoA to form succinyl-CoA. The nature of the beta subunit determines the nucleotide specificity.
  • Pathway

    Carbohydrate metabolism; tricarboxylic acid cycle.
  • Involvement in disease

    Mitochondrial DNA depletion syndrome 9
  • Sequence similarities

    Belongs to the succinate/malate CoA ligase alpha subunit family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ21114 antibody
    • FLJ43513 antibody
    • GALPHA antibody
    • MTDPS9 antibody
    • SCS alpha antibody
    • SCS-alpha antibody
    • SUCA_HUMAN antibody
    • Succinate CoA ligase alpha subunit antibody
    • Succinyl CoA ligase [GDP forming] subunit alpha mitochondrial antibody
    • Succinyl CoA synthetase subunit alpha antibody
    • Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial antibody
    • Succinyl-CoA synthetase subunit alpha antibody
    • SUCLA1 antibody
    • SUCLG 1 antibody
    • SUCLG1 antibody
    see all

Images

  • All lanes : Anti-SUCLG1 antibody (ab204432) at 1/100 dilution

    Lane 1 : RT-4 lysate
    Lane 2 : U-251 MG lysate

    Predicted band size: 36 kDa

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human kidney tissue labeling SUCLG1 with ab204432 at 1/1000.

References

ab204432 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204432.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up