Overview

  • Product name

  • Description

    Rabbit polyclonal to SUCLG2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Pig
  • Immunogen

    Recombinant fragment corresponding to Human SUCLG2 aa 363-432.
    Sequence:

    FGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQKILNNSGLPI TSAIDLEDAAKKAVASVAKK


    Database link: Q96I99

  • Positive control

    • Human kidney tissue; HepG2 cells; RT4 and U-251MG sp cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab187996 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/1000 - 1/2500. Predicted molecular weight: 47 kDa.
IHC-P 1/5000 - 1/10000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Catalyzes the GTP-dependent ligation of succinate and CoA to form succinyl-CoA.
  • Tissue specificity

    Mainly expressed in liver, kidney, heart, spleen and skeletal muscle. Also found in intestine and colon, and in low amounts in lung, brain, prostate, testis and ovary.
  • Pathway

    Carbohydrate metabolism; tricarboxylic acid cycle.
  • Sequence similarities

    Belongs to the succinate/malate CoA ligase beta subunit family.
    Contains 1 ATP-grasp domain.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 6.2.1.4 antibody
    • G BETA antibody
    • GBETA antibody
    • GTP specific succinyl-CoA synthetase beta subunit antibody
    • GTP specific succinyl-CoA synthetase subunit beta antibody
    • GTP-specific succinyl-CoA synthetase subunit beta antibody
    • mitochondrial antibody
    • SCS betaG antibody
    • SCS-betaG antibody
    • SUCB2_HUMAN antibody
    • Succinate CoA ligase GDP forming beta subunit antibody
    • Succinate-Coenzyme A ligase, GDP-forming, beta subunit antibody
    • Succinyl CoA ligase GDP forming beta chain mitochondrial antibody
    • Succinyl CoA synthetase betaG chain antibody
    • Succinyl-CoA ligase [GDP-forming] subunit beta antibody
    • Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial antibody
    • Succinyl-CoA synthetase beta-G chain antibody
    • SUCLG2 antibody
    see all

Images

  • All lanes : Anti-SUCLG2 antibody (ab187996) at 1/1000 dilution

    Lane 1 : RT4 cell lysate
    Lane 2 : U-251MG sp cell lysate

    Predicted band size: 47 kDa

  • Immunofluorescent analysis of PFA/Triton X-100-treated HepG2 cells labeling SUCLG2 with ab187996 at 4 µg/ml.

  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling SUCLG2 with ab187996 at 1/5000 dilution.

References

ab187996 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187996.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up