Anti-SUGT1 antibody (ab204428)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-SUGT1 antibody -
Description
Rabbit polyclonal to SUGT1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow
-
Immunogen
Recombinant fragment corresponding to Human SUGT1 aa 297-363.
Sequence:EEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSD VGKRKVEINPPDDMEWK
Database link: Q9Y2Z0 -
Positive control
- RT-4, U-251 MG, Human plasma and Human liver lysates; Human testis tissue; A431 cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, 59% PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab204428 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| WB | 1/100 - 1/250. Predicted molecular weight: 41 kDa. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. |
Target
-
Function
May play a role in ubiquitination and subsequent proteasomal degradation of target proteins. -
Sequence similarities
Belongs to the SGT1 family.
Contains 1 CS domain.
Contains 1 SGS domain.
Contains 3 TPR repeats. -
Domain
The CS domain mediates interaction with HSP90. -
Post-translational
modificationsPhosphorylated at Ser-281 and Ser-331, dephosphorylation promotes nuclear translocation, most likely due to disruption of the SUGT1-HSP90 complex. -
Cellular localization
Cytoplasm. Nucleus. Translocates to the nucleus upon heat shock, requiring S100A6. - Information by UniProt
-
Database links
- Entrez Gene: 515509 Cow
- Entrez Gene: 10910 Human
- Entrez Gene: 67955 Mouse
- Entrez Gene: 290408 Rat
- Omim: 604098 Human
- SwissProt: Q2KIK0 Cow
- SwissProt: Q9Y2Z0 Human
- SwissProt: Q9CX34 Mouse
see all -
Alternative names
- Protein 40 6 3 antibody
- Protein 40-6-3 antibody
- Protein SGT1 homolog antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SUGT1 antibody (ab204428)Immunohistochemical analysis of formalin-fixed paraffin-embedded Human testis tissue labeling SUGT1 with ab204428 at 1/50 dilution.
-
Western blot - Anti-SUGT1 antibody (ab204428)All lanes : Anti-SUGT1 antibody (ab204428) at 1/100 dilution
Lane 1 : RT-4 lysate
Lane 2 : U-251 MG lysate
Lane 3 : Human plasma lysate
Lane 4 : Human liver lysate
Predicted band size: 41 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-SUGT1 antibody (ab204428)Immunofluorescent analysis of formalin fixed, triton X-100 permealized A431 cells labeling SUGT1 with ab204428 at 4 µg/ml (green).
Protocols
Datasheets and documents
References
ab204428 has not yet been referenced specifically in any publications.
