Anti-SUGT1 antibody (ab204428)
Key features and details
- Rabbit polyclonal to SUGT1
- Suitable for: IHC-P, WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SUGT1 antibody -
Description
Rabbit polyclonal to SUGT1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow -
Immunogen
Recombinant fragment corresponding to Human SUGT1 aa 297-363.
Sequence:EEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSD VGKRKVEINPPDDMEWK
Database link: Q9Y2Z0 -
Positive control
- RT-4, U-251 MG, Human plasma and Human liver lysates; Human testis tissue; A431 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab204428 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 41 kDa. | |
ICC/IF | Use a concentration of 1 - 4 µg/ml. |
Target
-
Function
May play a role in ubiquitination and subsequent proteasomal degradation of target proteins. -
Sequence similarities
Belongs to the SGT1 family.
Contains 1 CS domain.
Contains 1 SGS domain.
Contains 3 TPR repeats. -
Domain
The CS domain mediates interaction with HSP90. -
Post-translational
modificationsPhosphorylated at Ser-281 and Ser-331, dephosphorylation promotes nuclear translocation, most likely due to disruption of the SUGT1-HSP90 complex. -
Cellular localization
Cytoplasm. Nucleus. Translocates to the nucleus upon heat shock, requiring S100A6. - Information by UniProt
-
Database links
- Entrez Gene: 515509 Cow
- Entrez Gene: 10910 Human
- Entrez Gene: 67955 Mouse
- Entrez Gene: 290408 Rat
- Omim: 604098 Human
- SwissProt: Q2KIK0 Cow
- SwissProt: Q9Y2Z0 Human
- SwissProt: Q9CX34 Mouse
see all -
Alternative names
- Protein 40 6 3 antibody
- Protein 40-6-3 antibody
- Protein SGT1 homolog antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SUGT1 antibody (ab204428)
Immunohistochemical analysis of formalin-fixed paraffin-embedded Human testis tissue labeling SUGT1 with ab204428 at 1/50 dilution.
-
All lanes : Anti-SUGT1 antibody (ab204428) at 1/100 dilution
Lane 1 : RT-4 lysate
Lane 2 : U-251 MG lysate
Lane 3 : Human plasma lysate
Lane 4 : Human liver lysate
Predicted band size: 41 kDa -
Immunofluorescent analysis of formalin fixed, triton X-100 permealized A431 cells labeling SUGT1 with ab204428 at 4 µg/ml (green).
Protocols
Datasheets and documents
References (0)
ab204428 has not yet been referenced specifically in any publications.