Overview

  • Product name

    Anti-Sulfatase 2/SULF2 antibody
    See all Sulfatase 2/SULF2 primary antibodies
  • Description

    Rabbit polyclonal to Sulfatase 2/SULF2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment corresponding to Human Sulfatase 2/SULF2 aa 337-649. N-terminal His-tag and GST-tag; Expressed in E.coli.
    Sequence:

    FDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPADMDGKSI LKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFL PKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATGKLKLHKCKGPMRLGGS RALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRS IRSVAIEVDGRVYHVGLGDAAQPRNLTKRHWPGAPEDQDDKDGGDFSGTG GLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIE TLQNKIKNLREVR


    Database link: Q8IWU5

  • Positive control

    • WB: Pig liver lysate; Recombinant human Sulfatase 2/SULF2 protein. IHC-P: Human stomach tissue. ICC/IF: HepG2 cells.
  • General notes

     This product was previously labelled as Sulfatase 2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab232835 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 100 kDa.
ICC/IF Use a concentration of 5 - 20 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Exhibits arylsulfatase activity and highly specific endoglucosamine-6-sulfatase activity. It can remove sulfate from the C-6 position of glucosamine within specific subregions of intact heparin.
  • Tissue specificity

    Expressed at highest levels in the ovary, skeletal muscle, stomach, brain, uterus, heart, kidney and placenta.
  • Sequence similarities

    Belongs to the sulfatase family.
  • Post-translational
    modifications

    The conversion to 3-oxoalanine (also known as C-formylglycine, FGly), of a serine or cysteine residue in prokaryotes and of a cysteine residue in eukaryotes, is critical for catalytic activity.
  • Cellular localization

    Endoplasmic reticulum. Golgi apparatus > Golgi stack. Cell surface. Also localized on the cell surface.
  • Information by UniProt
  • Database links

  • Alternative names

    • Extracellular sulfatase Sulf 2 antibody
    • Extracellular sulfatase Sulf-2 antibody
    • HSulf-2 antibody
    • HSulf2 antibody
    • Sulf2 antibody
    • SULF2_HUMAN antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for Sulfatase 2/SULF2 using ab232835 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Sulfatase 2/SULF2 antibody (ab232835) at 2 µg/ml + Pig liver lysate

    Predicted band size: 100 kDa

  • Anti-Sulfatase 2/SULF2 antibody (ab232835) at 2 µg/ml + Recombinant human Sulfatase 2/SULF2 protein

    Predicted band size: 100 kDa

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for Sulfatase 2/SULF2 using ab232835 at 20 µg/ml in ICC/IF. FITC-labeled secondary antibody.

References

ab232835 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232835.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up