Overview

  • Product name

    Anti-Sulfite oxidase antibody
    See all Sulfite oxidase primary antibodies
  • Description

    Rabbit polyclonal to Sulfite oxidase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Cow
    Predicted to work with: Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Bovine Sulfite oxidase aa 177-403 (N terminal). (Expressed in E.coli).
    Sequence:

    PYADDPIRHSALKVNTQHPFNAEPPPELLTENYITPNPIFFTRNHLPVPN VDPDTYRLNVVGPPGGQSLCLSLDDLYQFPKHEITVTLQCAGNRRSEMTQ FKEVRGLEWSLGAISTARWAGARLCDVLAQAGYQLCETEAHVCFEGLDSD PTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVG ARHVKWLGKVSVEPEESFSHWQRRDYK


    Database link: F6RUR3

  • Positive control

    • WB: Mouse liver; Cow serum, liver and heart lysate; Rat Liver lysate.
  • General notes

    Previously labelled as SUOX.

Properties

Applications

Our Abpromise guarantee covers the use of ab231144 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 60 kDa.

Target

  • Pathway

    Energy metabolism; sulfur metabolism.
  • Involvement in disease

    Defects in SUOX are the cause of isolated sulfite oxidase deficiency (ISOD) [MIM:272300]; also known as sulfocysteinuria. ISOD is characterized by neurological abnormalities including multicystic leukoencephalopathy with brain atrophy. Patients often suffer from seizures. Often leads to death at an early age.
  • Sequence similarities

    Contains 1 cytochrome b5 heme-binding domain.
  • Cellular localization

    Mitochondrion intermembrane space.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 1.8.3.1 antibody
    • mitochondrial antibody
    • Sulfite oxidase antibody
    • Sulfite oxidase mitochondrial antibody
    • Sulfite oxidase, mitochondrial precursor antibody
    • Suox antibody
    • SUOX_HUMAN antibody
    see all

Images

  • All lanes : Anti-Sulfite oxidase antibody (ab231144) at 2 µg/ml

    Lane 1 : Cow serum.
    Lane 2 : Cow liver tissue lysate
    Lane 3 : Cow heart tissue lysate
    Lane 4 : Rat liver tissue lysate
    Lane 5 : Mouse liver tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit Ab at 1/1000 dilution

    Predicted band size: 60 kDa

  • Anti-Sulfite oxidase antibody (ab231144) at 2 µg/ml + Rat liver lysate.

    Predicted band size: 60 kDa

  • Anti-Sulfite oxidase antibody (ab231144) at 2 µg/ml + Cow heart lysate.

    Predicted band size: 60 kDa

  • Anti-Sulfite oxidase antibody (ab231144) at 2 µg/ml + Cow liver lysate.

    Predicted band size: 60 kDa

  • Anti-Sulfite oxidase antibody (ab231144) at 2 µg/ml + Cow serum.

    Predicted band size: 60 kDa

  • Anti-Sulfite oxidase antibody (ab231144) at 2 µg/ml + Mouse liver lysate.

    Predicted band size: 60 kDa

  • Anti-Sulfite oxidase antibody (ab231144) at 2 µg/ml + Recombinant cow Sulfite oxidase protein.

    Predicted band size: 60 kDa

References

ab231144 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231144.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up