Overview

  • Product name

    Anti-Sulfite oxidase antibody
    See all Sulfite oxidase primary antibodies
  • Description

    Rabbit polyclonal to Sulfite oxidase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human Sulfite oxidase aa 80-545. (N-terminal His-tag and S-tag; Expressed in E.coli).
    Sequence:

    ESTHIYTKEEVSSHTSPETGIWVTLGSEVFDVTEFVDLHPGGPSKLMLAA GGPLEPFWALYAVHNQSHVRELLAQYKIGELNPEDKVAPTVETSDPYADD PVRHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDT YRLHVVGAPGGQSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVK GLEWRTGAISTARWAGARLCDVLAQAGHQLCETEAHVCFEGLDSDPTGTA YGASIPLARAMDPEAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVK WLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSIQELPVQSAI TEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEE QRPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLR GVLSNAWHRVHVYVSP


    Database link: P51687

  • Positive control

    • IHC-P: Human liver, stomach and kidney tissues. WB: Human liver, HEK-293T cell lysate; Mouse heart and liver lysates; Recombinant human Sulfite oxidase protein.
  • General notes

    Previously labelled as SUOX.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab233186 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233186 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 60 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Pathway

    Energy metabolism; sulfur metabolism.
  • Involvement in disease

    Defects in SUOX are the cause of isolated sulfite oxidase deficiency (ISOD) [MIM:272300]; also known as sulfocysteinuria. ISOD is characterized by neurological abnormalities including multicystic leukoencephalopathy with brain atrophy. Patients often suffer from seizures. Often leads to death at an early age.
  • Sequence similarities

    Contains 1 cytochrome b5 heme-binding domain.
  • Cellular localization

    Mitochondrion intermembrane space.
  • Information by UniProt
  • Database links

    • Alternative names

      • EC 1.8.3.1 antibody
      • mitochondrial antibody
      • Sulfite oxidase antibody
      • Sulfite oxidase mitochondrial antibody
      • Sulfite oxidase, mitochondrial precursor antibody
      • Suox antibody
      • SUOX_HUMAN antibody
      see all

    Images

    • Paraffin-embedded human liver tissue stained for Sulfite oxidase using ab233186 at 20 µg/ml in immunohistochemical analysis. DAB staining.

    • Paraffin-embedded human stomach tissue stained for Sulfite oxidase using ab233186 at 20 µg/ml in immunohistochemical analysis. DAB staining.

    • Paraffin-embedded human kidney tissue stained for Sulfite oxidase using ab233186 at 20 µg/ml in immunohistochemical analysis. DAB staining.

    • Anti-Sulfite oxidase antibody (ab233186) at 2 µg/ml + Recombinant human Sulfite oxidase protein

      Predicted band size: 60 kDa

    • Anti-Sulfite oxidase antibody (ab233186) at 2 µg/ml + Human liver lysate

      Predicted band size: 60 kDa

    • Anti-Sulfite oxidase antibody (ab233186) at 2 µg/ml + HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

      Predicted band size: 60 kDa

    • Anti-Sulfite oxidase antibody (ab233186) at 2 µg/ml + Mouse heart lysate

      Predicted band size: 60 kDa

    • Anti-Sulfite oxidase antibody (ab233186) at 2 µg/ml + Mouse liver lysate

      Predicted band size: 60 kDa

    References

    ab233186 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab233186.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up