Overview

  • Product name

  • Description

    Rabbit polyclonal to SULT1A1/STP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse SULT1A1/STP aa 3-285. (Expressed in E.coli).
    Sequence:

    PLRKPLVPVKGIPLIKYFAETMEQLQNFTAWPDDVLISTYPKSGTNWMSE IMDMIYQGGKLDKCGRAPVYARIPFLEFSCPGVPPGLETLKETPAPRIIK THLPLSLLPQSLLDQKIKVIYVARNAKDVVVSYYNFYKMAKLHPDPGTWE SFLENFMDGKVSYGSWYQHVKEWWELRRTHPVLYLFYEDMKENPKREIKK ILEFLGRSLPEETVDLIVHHTSFKKMKENPMANYTTIPTEVMDHTIYPFM RKGTIGDWKNTFTVAQSEHFDAHYAKLMTGCDF


    Database link: P52840

  • Positive control

    • IHC-P: Mouse liver tissue. WB: Mouse and rat liver lysates; Recombinant mouse SULT1A1/STP protein.
  • General notes

     This product was previously labelled as SULT1A1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231555 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 34 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Catalyzes the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Is also responsible for the sulfation and activation of minoxidil. Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk.
  • Tissue specificity

    Liver, lung, adrenal, brain, platelets and skin.
  • Sequence similarities

    Belongs to the sulfotransferase 1 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Aryl sulfotransferase 1 antibody
    • HAST1/HAST2 antibody
    • Human aryl sulfotransferase mRNA complete cds antibody
    • MGC131921 antibody
    • MGC5163 antibody
    • OTTHUMP00000162568 antibody
    • OTTHUMP00000162569 antibody
    • P PST 1 antibody
    • P PST antibody
    • P-PST 1 antibody
    • Phenol sulfating phenol sulfotransferase 1 antibody
    • Phenol sulfotransferase 1 antibody
    • Phenol-sulfating phenol sulfotransferase 1 antibody
    • PST antibody
    • ST1A1 antibody
    • ST1A1_HUMAN antibody
    • ST1A3 antibody
    • STP antibody
    • STP1 antibody
    • Sulfotransferase 1A1 antibody
    • Sulfotransferase family 1A phenol preferring member 1 antibody
    • Sulfotransferase family cytosolic 1A phenol preferring member 1 antibody
    • Sulfotransferase phenol preferring 1 antibody
    • SULT1A1 antibody
    • Thermostable phenol sulfotransferase antibody
    • Thermostable phenol sulfotransferase1 antibody
    • Ts-PST antibody
    • TSPST1 antibody
    see all

Images

  • Paraffin-embedded mouse liver tissue stained for SULT1A1/STP using ab231555 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse liver tissue stained for SULT1A1/STP using ab231555 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-SULT1A1/STP antibody (ab231555) at 3 µg/ml + Recombinant mouse SULT1A1/STP protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 34 kDa

  • All lanes : Anti-SULT1A1/STP antibody (ab231555) at 3 µg/ml

    Lane 1 : Mouse liver lysate
    Lane 2 : Rat liver lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 34 kDa

References

ab231555 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231555.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up