Overview

  • Product name

    Anti-Sumo 2 + Sumo 3 antibody [SM23/496]
    See all Sumo 2 + Sumo 3 primary antibodies
  • Description

    Mouse monoclonal [SM23/496] to Sumo 2 + Sumo 3
  • Host species

    Mouse
  • Tested applications

    Suitable for: ICC/IF, IP, WB, IHC-P, Flow Cyt, IHC-Frmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: a wide range of other species
  • Immunogen

    Recombinant full length protein corresponding to Human Sumo 2 + Sumo 3 aa 1-95. Full length recombinant human SUMO2
    Sequence:

    MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCER QGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY


    Database link: P61956

  • Positive control

    • HeLa cells; breast carcinoma and tonsil tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: 0.05% BSA, PBS
  • Concentration information loading...
  • Purification notes

    200ug/ml of Ab purified from Bioreactor Concentrate by Protein A/G
  • Clonality

    Monoclonal
  • Clone number

    SM23/496
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190757 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 0.5 - 1 µg/ml.
IP Use at 1-2 µg/mg of lysate.
WB Use a concentration of 0.5 - 1 µg/ml. Predicted molecular weight: 11,13 kDa.
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Flow Cyt Use 0.5-1µg for 106 cells.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

IHC-Fr Use a concentration of 0.5 - 1 µg/ml.

Target

  • Relevance

    SUMO proteins, such as Sumo 2 and Sumo 3, post-translationally modify numerous cellular proteins and affect their metabolism and function. However, unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. Sumo 2 and Sumo 3 are highly homologous, hence it is very difficult to produce antibodies which distinguish them.
  • Cellular localization

    Cytoplasmic (SUMO3) and Nuclear (SUMO2)
  • Database links

  • Alternative names

    • HSMT3 antibody
    • MGC117191 antibody
    • OTTHUMP00000115275 antibody
    • OTTHUMP00000115276 antibody
    • OTTHUMP00000115277 antibody
    • Sentrin 2 antibody
    • Small ubiquitin like modifier 2 antibody
    • Small ubiquitin like modifier 3 antibody
    • Small ubiquitin related modifier 2 antibody
    • Small ubiquitin related modifier 3 antibody
    • small ubiquitin-like modifier 3 antibody
    • small ubiquitin-related modifier 3 antibody
    • SMT3 homolog 1 antibody
    • SMT3 homolog 2 antibody
    • SMT3 suppressor of mif two 3 homolog 1 antibody
    • SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) antibody
    • SMT3 suppressor of mif two 3 homolog 2 antibody
    • SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) antibody
    • SMT3 suppressor of mif two 3 homolog 3 antibody
    • SMT3A antibody
    • SMT3B antibody
    • SMT3H1 antibody
    • SMT3H2 antibody
    • Sumo2 antibody
    • Sumo3 antibody
    • Ubiquitin like protein SMT3A antibody
    • Ubiquitin like protein SMT3B antibody
    • Ubiquitin-like protein SMT3B antibody
    see all

Images

  • Anti-Sumo 2 + Sumo 3 antibody [SM23/496] (ab190757) at 1 µg/ml + HeLa cell lysate

    Predicted band size: 11,13 kDa

  • Immunohistochemical analysis of paraffin-embedded Human tonsil tissue, labeling Sumo 2+3 using ab190757 at 1 µg/ml.

References

ab190757 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (U2OS)
Permeabilization
Yes - 0.5% Triton 5 minutes
Specification
U2OS
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 25°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Dec 14 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up