Overview

  • Product name

  • Description

    Rabbit polyclonal to Sumo 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Chicken, Cow, Xenopus laevis, Zebrafish, Cynomolgus monkey, Chinese hamster, Xenopus tropicalis
  • Immunogen

    Recombinant full length protein corresponding to Human Sumo 2 aa 1-95. N-terminal His-tag and GST-tag. Expressed in E.coli.
    Sequence:

    MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCER QGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY


    Database link: P61956

  • Positive control

    • WB: Recombinant human Sumo 2 proteim; Pig liver and cerebrum tissue lysates; HeLa whole cell lysate (ab150035). IHC-P: Human lung tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233222 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 11 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded human lung tissue stained for Sumo 2 using ab233222 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Sumo 2 antibody (ab233222) at 1 µg/ml + Pig liver lysate

    Secondary
    HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml

    Predicted band size: 11 kDa

  • Anti-Sumo 2 antibody (ab233222) at 1 µg/ml + Pig cerebrum lysate

    Secondary
    HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml

    Predicted band size: 11 kDa

  • Anti-Sumo 2 antibody (ab233222) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Secondary
    HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml

    Predicted band size: 11 kDa

  • Anti-Sumo 2 antibody (ab233222) at 2 µg/ml + Recombinant human Sumo 2 protein

    Predicted band size: 11 kDa

References

ab233222 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233222.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up