Overview

  • Product name

    Anti-Superoxide Dismutase 1 antibody
    See all Superoxide Dismutase 1 primary antibodies
  • Description

    Rabbit polyclonal to Superoxide Dismutase 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chicken
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Chicken Superoxide Dismutase 1 aa 2-154. Expressed in E. coli. N-terminal tags.
    Sequence:

    ATLKAVCVMKGDAPVEGVIHFQQQGSGPVKVTGKITGLSDGDHGFHVHEF GDNTNGCTSAGAHFNPEGKQHGGPKDADRHVGDLGNVTAKGGVAEVEIED SVISLTGPHCIIGRTMVVHAKSDDLGRGGDNESKLTGNAGPRLACGVIGI AKC


    Database link: P80566

  • Positive control

    • WB: Recombinant chicken Superoxide Dismutase 1 protein. Jurkat and HeLa cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab232863 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    Destroys radicals which are normally produced within the cells and which are toxic to biological systems.
  • Involvement in disease

    Defects in SOD1 are the cause of amyotrophic lateral sclerosis type 1 (ALS1) [MIM:105400]. ALS1 is a familial form of amyotrophic lateral sclerosis, a neurodegenerative disorder affecting upper and lower motor neurons and resulting in fatal paralysis. Sensory abnormalities are absent. Death usually occurs within 2 to 5 years. The etiology of amyotrophic lateral sclerosis is likely to be multifactorial, involving both genetic and environmental factors. The disease is inherited in 5-10% of cases leading to familial forms.
  • Sequence similarities

    Belongs to the Cu-Zn superoxide dismutase family.
  • Post-translational
    modifications

    Unlike wild-type protein, the pathogenic variants ALS1 Arg-38, Arg-47, Arg-86 and Ala-94 are polyubiquitinated by RNF19A leading to their proteasomal degradation. The pathogenic variants ALS1 Arg-86 and Ala-94 are ubiquitinated by MARCH5 leading to their proteasomal degradation.
    The ditryptophan cross-link at Trp-33 is reponsible for the non-disulfide-linked homodimerization. Such modification might only occur in extreme conditions and additional experimental evidence is required.
  • Cellular localization

    Cytoplasm. The pathogenic variants ALS1 Arg-86 and Ala-94 gradually aggregates and accumulates in mitochondria.
  • Information by UniProt
  • Database links

  • Alternative names

    • ALS antibody
    • ALS1 antibody
    • Amyotrophic lateral sclerosis 1 adult antibody
    • Cu/Zn SOD antibody
    • Cu/Zn superoxide dismutase antibody
    • Epididymis secretory protein Li 44 antibody
    • HEL S 44 antibody
    • Homodimer antibody
    • hSod1 antibody
    • Indophenoloxidase A antibody
    • IPOA antibody
    • Mn superoxide dismutase antibody
    • SOD antibody
    • SOD soluble antibody
    • SOD1 antibody
    • SOD2 antibody
    • SODC antibody
    • SODC_HUMAN antibody
    • Superoxide dismutase [Cu-Zn] antibody
    • Superoxide dismutase 1 antibody
    • Superoxide dismutase 1 soluble antibody
    • Superoxide dismutase Cu Zn antibody
    • Superoxide dismutase cystolic antibody
    see all

Images

  • Anti-Superoxide Dismutase 1 antibody (ab232863) at 3 µg/ml + HeLa (Human epithelial cell line from cervix adenocarcinoma) cell lysate
  • Anti-Superoxide Dismutase 1 antibody (ab232863) at 3 µg/ml + Jurkat (Human T cell leukemia cell line from peripheral blood) cell lysate
  • Anti-Superoxide Dismutase 1 antibody (ab232863) at 2 µg/ml + Recombinant chicken Superoxide Dismutase 1 protein

References

ab232863 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232863.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up