Overview

  • Product name

    Anti-Superoxide Dismutase 4/CCS antibody
    See all Superoxide Dismutase 4/CCS primary antibodies
  • Description

    Rabbit polyclonal to Superoxide Dismutase 4/CCS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human Superoxide Dismutase 4/CCS aa 81-165.
    Sequence:

    GQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLH VHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHR


    Database link: O14618

  • Positive control

    • WB; Human liver tissue extract. IHC-P; Human testis tissue.
  • General notes

    Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

     This product was previously labelled as Superoxide Dismutase 4

     

Properties

Applications

Our Abpromise guarantee covers the use of ab220330 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 29 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded, formalin fixed Human testis tissue labeling Superoxide Dismutase 4/CCS with ab220330 at 1/200 dilution.

  • All lanes : Anti-Superoxide Dismutase 4/CCS antibody (ab220330) at 1/100 dilution

    Lane 1 : RT4 cell extract
    Lane 2 : U-251 MG cell extract
    Lane 3 : Human plasma
    Lane 4 : Human liver tissue extract

    Developed using the ECL technique.

    Predicted band size: 29 kDa

References

ab220330 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220330.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up