Overview

  • Product name

    Anti-Superoxide Dismutase 4/CCS antibody
    See all Superoxide Dismutase 4/CCS primary antibodies
  • Description

    Rabbit polyclonal to Superoxide Dismutase 4/CCS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Superoxide Dismutase 4/CCS aa 23-269. Expressed in E.coli.
    Sequence:

    QSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQ AVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGL EPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVR ADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSG ERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQ


    Database link: O14618

  • Positive control

    • WB: Recombinant human Superoxide Dismutase 4/CCS protein; Human lung lysate; HepG2, HeLa and Jurkat cell lysates. IHC-P: Human breast cancer and prostate tissue.
  • General notes

     This product was previously labelled as Superoxide Dismutase 4

     

Properties

Applications

Our Abpromise guarantee covers the use of ab233285 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 29 kDa.

Target

  • Function

    Delivers copper to copper zinc superoxide dismutase (SOD1).
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    In the C-terminal section; belongs to the Cu-Zn superoxide dismutase family.
    Contains 1 HMA domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • CCS antibody
    • CCS_HUMAN antibody
    • Copper chaperone for superoxide dismutase antibody
    • MGC138260 antibody
    • SOD 4 antibody
    • SOD4 antibody
    • Superoxide dismutase copper chaperone antibody
    see all

Images

  • All lanes : Anti-Superoxide Dismutase 4/CCS antibody (ab233285) at 1 µg/ml

    Lane 1 : Human lung lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 4 : Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 29 kDa

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for Superoxide Dismutase 4/CCS using ab233285 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for Superoxide Dismutase 4/CCS using ab233285 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Superoxide Dismutase 4/CCS antibody (ab233285) at 1 µg/ml + Recombinant human Superoxide Dismutase 4/CCS protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 29 kDa

References

ab233285 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233285.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up