Overview

  • Product name

  • Description

    Rabbit polyclonal to SUPT16H
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Xenopus laevis
  • Immunogen

    Recombinant fragment corresponding to Human SUPT16H aa 187-282.
    Sequence:

    ASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADP STVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSY


    Database link: Q9Y5B9

  • Positive control

    • Human rectum tissue; RT-4 and U-251 MG cell lysates, Human plasma and Human tonsil tissue lysates; U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204343 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 120 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates the passage of RNA polymerase II and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes the reestablishment of the nucleosome following the passage of RNA polymerase II. The FACT complex is probably also involved in phosphorylation of 'Ser-392' of p53/TP53 via its association with CK2 (casein kinase II). Also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the peptidase M24 family. SPT16 subfamily.
  • Domain

    The Glu-rich acidic region in C-terminus is essential for FACT activity.
  • Post-translational
    modifications

    ADP-ribosylated. ADP-ribosylation by PARP1 is induced by genotoxic stress and correlates with dissociation of FACT from chromatin.
  • Cellular localization

    Nucleus. Chromosome. Colocalizes with RNA polymerase II on chromatin. Recruited to actively transcribed loci.
  • Information by UniProt
  • Database links

  • Alternative names

    • CDC68 antibody
    • Chromatin specific transcription elongation factor 140 kDa subunit antibody
    • Chromatin-specific transcription elongation factor 140 kDa subunit antibody
    • Facilitates chromatin transcription complex subunit SPT16 antibody
    • FACT 140 kDa subunit antibody
    • FACT antibody
    • FACT complex subunit SPT16 antibody
    • FACTp140 antibody
    • FLJ10857 antibody
    • FLJ14010 antibody
    • hSPT16 antibody
    • SP16H_HUMAN antibody
    • Suppressor of Ty 16 homolog antibody
    • Supt16h antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human rectum tissue labeling SUPT16H with ab204343 at 1/1000 dilution.

  • All lanes : Anti-SUPT16H antibody (ab204343) at 1/500 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Developed using the ECL technique.

    Predicted band size: 120 kDa

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling SUPT16H with ab204343 at 4 µg/ml (green).

References

This product has been referenced in:

  • Porter LF  et al. A role for repressive complexes and H3K9 di-methylation in PRDM5-associated brittle cornea syndrome. Hum Mol Genet 24:6565-79 (2015). IHC-P ; Human . Read more (PubMed: 26395458) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204343.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up