Overview

  • Product name

  • Description

    Rabbit polyclonal to SUPT4H
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Xenopus laevis, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human SUPT4H aa 1-117.
    Sequence:

    MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVY DCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRE LKSRGVAYKSRDTAIKT


    Database link: P63272

  • Positive control

    • WB: Human tonsil and testis tissues.
  • General notes

     This product was previously labelled as Suppressor of Ty 4 homolog 1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab230086 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Component of the DRB sensitivity-inducing factor complex (DSIF complex), which regulates mRNA processing and transcription elongation by RNA polymerase II. DSIF positively regulates mRNA capping by stimulating the mRNA guanylyltransferase activity of RNGTT/CAP1A. DSIF also acts cooperatively with the negative elongation factor complex (NELF complex) to enhance transcriptional pausing at sites proximal to the promoter. Transcriptional pausing may facilitate the assembly of an elongation competent RNA polymerase II complex. DSIF and NELF promote pausing by inhibition of the transcription elongation factor TFIIS/S-II. TFIIS/S-II binds to RNA polymerase II at transcription pause sites and stimulates the weak intrinsic nuclease activity of the enzyme. Cleavage of blocked transcripts by RNA polymerase II promotes the resumption of transcription from the new 3' terminus and may allow repeated attempts at transcription through natural pause sites. DSIF can also positively regulate transcriptional elongation and is required for the efficient activation of transcriptional elongation by the HIV-1 nuclear transcriptional activator, Tat. DSIF acts to suppress transcriptional pausing in transcripts derived from the HIV-1 LTR and blocks premature release of HIV-1 transcripts at terminator sequences.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the SPT4 family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DRB sensitivity-inducing factor 14 kDa subunit antibody
    • DRB sensitivity-inducing factor small subunit antibody
    • DSIF p14 antibody
    • DSIF small subunit antibody
    • hSPT4 antibody
    • SPT4 antibody
    • SPT4H antibody
    • SPT4H_HUMAN antibody
    • SUPT4H `1 antibody
    • SUPT4H antibody
    • Supt4h1 antibody
    • Transcription elongation factor spt4 antibody
    see all

Images

  • Paraffin-embedded human tonsil tissue stained for SUPT4H using ab230086 at 1/100 dilution in immunohistochemical analysis.

  • Paraffinembedded human testis tissue stained for SUPT4H using ab230086 at 1/100 dilution in immunohistochemical analysis.

References

ab230086 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230086.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up