Anti-SUPT4H antibody (ab230091)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-SUPT4H antibody
See all SUPT4H primary antibodies -
Description
Rabbit polyclonal to SUPT4H -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Cow, Xenopus laevis, Cynomolgus monkey, Orangutan -
Immunogen
Recombinant full length protein corresponding to Human SUPT4H aa 1-117.
Sequence:MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVY DCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRE LKSRGVAYKSRDTAIKT
Database link: P63272 -
Positive control
- IHC-P: Human tonsil and testis tissues.
-
General notes
This product was previously labelled as Suppressor of Ty 4 homolog 1
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab230091 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. |
Target
-
Function
Component of the DRB sensitivity-inducing factor complex (DSIF complex), which regulates mRNA processing and transcription elongation by RNA polymerase II. DSIF positively regulates mRNA capping by stimulating the mRNA guanylyltransferase activity of RNGTT/CAP1A. DSIF also acts cooperatively with the negative elongation factor complex (NELF complex) to enhance transcriptional pausing at sites proximal to the promoter. Transcriptional pausing may facilitate the assembly of an elongation competent RNA polymerase II complex. DSIF and NELF promote pausing by inhibition of the transcription elongation factor TFIIS/S-II. TFIIS/S-II binds to RNA polymerase II at transcription pause sites and stimulates the weak intrinsic nuclease activity of the enzyme. Cleavage of blocked transcripts by RNA polymerase II promotes the resumption of transcription from the new 3' terminus and may allow repeated attempts at transcription through natural pause sites. DSIF can also positively regulate transcriptional elongation and is required for the efficient activation of transcriptional elongation by the HIV-1 nuclear transcriptional activator, Tat. DSIF acts to suppress transcriptional pausing in transcripts derived from the HIV-1 LTR and blocks premature release of HIV-1 transcripts at terminator sequences. -
Tissue specificity
Widely expressed. -
Sequence similarities
Belongs to the SPT4 family. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 616425 Cow
- Entrez Gene: 101925811 Cynomolgus monkey
- Entrez Gene: 6827 Human
- Entrez Gene: 20922 Mouse
- Entrez Gene: 100190855 Orangutan
- Entrez Gene: 734253 Xenopus laevis
- Omim: 603555 Human
- SwissProt: Q3SYX6 Cow
see all -
Alternative names
- DRB sensitivity-inducing factor 14 kDa subunit antibody
- DRB sensitivity-inducing factor small subunit antibody
- DSIF p14 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SUPT4H antibody (ab230091)
Paraffin-embedded human tonsil tissue stained for SUPT4H using ab230091 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SUPT4H antibody (ab230091)
Paraffin-embedded human testis tissue stained for SUPT4H using ab230091 at 1/100 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab230091 has not yet been referenced specifically in any publications.