SureLight® APC Anti-PGE2 receptor EP4 subtype antibody (ab92763)
Key features and details
- SureLight® APC Rabbit polyclonal to PGE2 receptor EP4 subtype
- Suitable for: ICC/IF
- Reacts with: Mouse, Rat, Sheep, Human
- Conjugation: SureLight® APC. Ex: 652nm, Em: 657nm
- Isotype: IgG
Overview
-
Product name
SureLight® APC Anti-PGE2 receptor EP4 subtype antibody
See all PGE2 receptor EP4 subtype primary antibodies -
Description
SureLight® APC Rabbit polyclonal to PGE2 receptor EP4 subtype -
Host species
Rabbit -
Conjugation
SureLight® APC. Ex: 652nm, Em: 657nm -
Specificity
ab92763 is reactive with EP4 receptor and non-reactive with EP1, EP2, and EP3 receptors. -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Rat, Sheep, Human
Predicted to work with: Rabbit, Cow, Chimpanzee, Cynomolgus monkey
-
Immunogen
Synthetic peptide corresponding to Human PGE2 receptor EP4 subtype aa 459-488 (C terminal).
Sequence:GSGRAGPAPKGSSLQVTFPSETLNLSEKCI
-
General notes
This product was previously labelled as Prostaglandin E Receptor EP4
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. Store In the Dark. -
Storage buffer
pH: 7.20
Preservative: 0.013% Sodium azide
Constituents: 1.64% Sodium phosphate, 0.58% Sodium chloride -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab92763 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 5 µg/ml. |
Target
-
Function
Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. Has a relaxing effect on smooth muscle. May play an important role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function. -
Tissue specificity
High in intestine and in peripheral blood mononuclear cells; low in lung, kidney, thymus, uterus, vasculature and brain. Not found in liver, heart, retina oe skeletal muscle. -
Sequence similarities
Belongs to the G-protein coupled receptor 1 family. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 450195 Chimpanzee
- Entrez Gene: 282331 Cow
- Entrez Gene: 5734 Human
- Entrez Gene: 19219 Mouse
- Entrez Gene: 100009081 Rabbit
- Entrez Gene: 84023 Rat
- Entrez Gene: 443222 Sheep
- Omim: 601586 Human
see all -
Alternative names
- EP 4 antibody
- EP4 antibody
- EP4R antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - SureLight® APC Anti-PGE2 receptor EP4 subtype antibody (ab92763)
ICC/IF image of ab92763 stained HeLa cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1% BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab92763, 5µg/ml) overnight at +4°C. The secondary antibody (green) was ab96899, DyLight® 488 goat anti-rabbit IgG (H+L) used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.
Protocols
References (2)
ab92763 has been referenced in 2 publications.
- Chen H et al. Prostaglandin E2 mediates sensory nerve regulation of bone homeostasis. Nat Commun 10:181 (2019). PubMed: 30643142
- Ni S et al. Sensory innervation in porous endplates by Netrin-1 from osteoclasts mediates PGE2-induced spinal hypersensitivity in mice. Nat Commun 10:5643 (2019). PubMed: 31822662
