Overview

  • Product name

  • Description

    Rabbit polyclonal to SUZ12
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human SUZ12 aa 131-305.
    Sequence:

    TFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQN SVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSL AVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEEL PARRKRNREDGEKTFVAQMTVFDKN


    Database link: Q15022

  • Positive control

    • WB: Rat kidney and liver lysates. IHC-P: Human kidney tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236322 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2000.
WB 1/500 - 1/5000. Predicted molecular weight: 83 kDa.
ICC/IF 1/50 - 1/500.

Target

  • Function

    Polycomb group (PcG) protein. Component of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' (H3K9me) and 'Lys-27' (H3K27me) of histone H3, leading to transcriptional repression of the affected target gene. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1 and CDKN2A.
  • Tissue specificity

    Overexpressed in breast and colon cancer.
  • Involvement in disease

    Note=A chromosomal aberration involving SUZ12 may be a cause of endometrial stromal tumors. Translocation t(7;17)(p15;q21) with JAZF1. The translocation generates the JAZF1-SUZ12 oncogene consisting of the N-terminus part of JAZF1 and the C-terminus part of SUZ12. It is frequently found in all cases of endometrial stromal tumors, except in endometrial stromal sarcomas, where it is rarer.
  • Sequence similarities

    Belongs to the VEFS (VRN2-EMF2-FIS2-SU(Z)12) family.
    Contains 1 C2H2-type zinc finger.
  • Developmental stage

    Expressed at low levels in quiescent cells. Expression rises at the G1/S phase transition.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • ChET 9 protein antibody
    • CHET9 antibody
    • Chromatin precipitated E2F target 9 protein antibody
    • JJAZ1 antibody
    • Joined to JAZF1 protein antibody
    • KIAA0160 antibody
    • Polycomb protein SUZ12 antibody
    • Suppressor of zeste 12 homolog antibody
    • Suppressor of zeste 12 protein homolog antibody
    • SUZ12 antibody
    • SUZ12 polycomb repressive complex 2 subunit antibody
    • SUZ12_HUMAN antibody
    see all

Images

  • All lanes : Anti-SUZ12 antibody (ab236322) at 1/500 dilution

    Lane 1 : Rat kidney lysate
    Lane 2 : Rat liver lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 83 kDa

  • Paraffin-embedded human kidney tissue stained for SUZ12 using ab236322 at 1/1000 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for SUZ12 (green) using ab236322 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

This product has been referenced in:

  • Xue C  et al. The Down-Regulation of SUZ12 Accelerates the Migration and Invasion of Liver Cancer Cells via Activating ERK1/2 Pathway. J Cancer 10:1375-1384 (2019). Read more (PubMed: 31031847) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236322.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up