Overview

  • Product name

  • Description

    Rabbit polyclonal to SV2A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human SV2A aa 62-166.
    Sequence:

    SDGYYRGEGTQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGE RMADGAPLAGVRGGLSDGEGPPGGRGEAQRRKEREELAQQYEAILRECGH GRFQW


    Database link: Q7L0J3

  • Positive control

    • IHC-P: Human cerebral cortex tissue. ICC/IF: U-251 MG cells. WB: U-87 MG, NIH/3T3 and NBT-II cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab224073 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

WB 1/250 - 1/500. Predicted molecular weight: 83 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Anti-SV2A antibody (ab224073) at 1/250 dilution + U-87 MG (human glioblastoma-astrocytoma epithelial cell line) cell lysate

    Predicted band size: 83 kDa

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for SV2A (green) using ab224073 (4 µg/ml) in ICC/IF.

  • Paraffin-embedded human cerebral cortex tissue stained for SV2A with ab224073 (1/50 dilution) in immunohistochemical analysis.

  • All lanes : Anti-SV2A antibody (ab224073) at 1/250 dilution

    Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
    Lane 2 : NBT-II (rat cell line) cell lysate

    Predicted band size: 83 kDa

References

ab224073 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224073.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up