Overview

  • Product name
    Anti-SV40 VP2 + VP3 antibody
  • Description
    Rabbit polyclonal to SV40 VP2 + VP3
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Simian Virus 40
  • Immunogen

    Recombinant fusion protein: MAVDLYRPDD YYDILFPGVQ TFVHSVQYLD PRHWGPTLFN AISQAFWRVI QNDIPRLTSQ ELERRTQRYL RDSLARFLEE TTWTVINAPV NWYNSLQDYY STLSPIRPTM VRQVANREGL QISFGHTYDN IDEADSIQQV TERWEAQSQS PNVQSGEFIE KFEAPGGANQ RTAPQWMLPL LLGLYGSVTS ALKAYEDGPN KKKRKLSRGS SQKTKGTSAS AKARHKRRNR SSRS

  • General notes


    This antibody recognises two of the SV40 capsid proteins - VP2 and VP3

Properties

Applications

Our Abpromise guarantee covers the use of ab53983 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent dilution. Predicted molecular weight: 38,26 kDa.
ICC/IF Use at an assay dependent dilution. PubMed: 19104450

Target

  • Relevance
    There are three simian virus 40 (SV40) capsid proteins - VP1, VP2 and VP3. VP1 assembles into pentamers which have a central cavity that contains a copy of one of the other capsid proteins, VP2 or VP3. This complex is then imported into the cell nucleus. Here, 72 of the complexes assemble around the newly synthesised viral genome to form the icosahedral capsid.
  • Database links

    Images

    • All lanes : Anti-SV40 VP2 + VP3 antibody (ab53983) at 1/5000 dilution

      Lane 1 : BK virus infected 293T cell lysate
      Lane 2 : Mock 293T cell lysate

      Lysates/proteins at 15 µg per lane.

      Secondary
      All lanes : HRP-conjugated goat anti-rabbit IgG polyclonal at 1/5000 dilution

      Developed using the ECL technique.

      Performed under reducing conditions.

      Predicted band size: 38,26 kDa
      Observed band size: 27,38 kDa
      why is the actual band size different from the predicted?


      Exposure time: 6 minutes

      See Abreview

    • SV40 was ultracentrifuged on CsCl-gradient, fractions were collected from the top of the tube, run on PAGE, and the gel was stained with Coumassie. Equal amounts of SV40 from fractions 3,4 and 6 were run on PAGE, and the gel was stained with Coumassie. Equal amounts of SV40 from fraction 3,4 and 6 were run on PAGe and analysed by Western blot with α-VP1 and α-VP2/3

    References

    This product has been referenced in:
    • Tsai K  et al. Addition of m6A to SV40 late mRNAs enhances viral structural gene expression and replication. PLoS Pathog 14:e1006919 (2018). Read more (PubMed: 29447282) »
    • Panou MM  et al. Agnoprotein Is an Essential Egress Factor during BK Polyomavirus Infection. Int J Mol Sci 19:N/A (2018). Read more (PubMed: 29562663) »
    See all 11 Publications for this product

    Customer reviews and Q&As

    1-5 of 5 Abreviews or Q&A

    Application
    Western blot
    Loading amount
    15 µg
    Gel Running Conditions
    Reduced Denaturing (10%)
    Sample
    Human Cell lysate - whole cell (BK virus infected 293TT cells)
    Specification
    BK virus infected 293TT cells
    Blocking step
    Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 20°C

    Abcam user community

    Verified customer

    Submitted Nov 18 2014

    Application
    Western blot
    Loading amount
    150000 cells
    Gel Running Conditions
    Reduced Denaturing (4-15%)
    Sample
    Simian Virus 40 (SV40) Cell lysate - nuclear (Sf9 insect cells)
    Specification
    Sf9 insect cells
    Blocking step
    Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 25°C

    Abcam user community

    Verified customer

    Submitted Nov 05 2013

    Answer

    I am so happy to hear that the replacement worked!  I wish you continued luck with your reseach and please do not hesitate to contact me if you should need any further assistance.  Have a great weekend!

    Read More

    Answer

    Thank you for your reply. I am sorry this product did not perform as stated on the datasheet and for the inconvenience this has caused. As requested, I have issued a free of charge replacement. To check the status of the order please contact our Customer Service team and reference this number. Please note that this free of charge replacement vial is also covered by our Abpromise guarantee. Should you still be experiencing difficulties, or if you have any further questions, please do not hesitate to let us know. I wish you the best of luck with your research.  

    Read More

    Answer

    Thank you for contacting Abcam regarding ab53983. The correct immunogen sequence is: MAVDLYRPDDYYDILFPGVQTFVHSVQYLDPRHWGPTLFNAISQAFWRVIQNDIPRLTSQELERRTQRYLRDSLARFLEETTWTVINAPVNWYNSLQDYYSTLSPIRPTMVRQVANREGLQISFGHTYDNIDEADSIQQVTERWEAQSQSPNVQSGEFIEKFEAPGGANQRTAPQWMLPLLLGLYGSVTSALKAYEDGPNKKKRKLSRGSSQKTKGTSASAKARHKRRNRSSRS This is identical to what is listed on our website except for the addition of the following amino acids:  KKKRKLSRGSSQKTKGTSASAKARHKRRNRSSRS I have requested that our datasheet be updated immediately. I hope this information is helpful.  Please do not hesitate to contact us if you have any additional questions.  

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up