Overview

  • Product name

    Anti-SYBL1/VAMP-7 antibody
    See all SYBL1/VAMP-7 primary antibodies
  • Description

    Rabbit polyclonal to SYBL1/VAMP-7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human SYBL1/VAMP-7 aa 100-187.
    Sequence:

    YAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIMVRNIDLVAQ RGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNL


    Database link: P51809

  • Positive control

    • IHC-P: Human pancreas tissue. ICC/IF: U-251 MG cells.
  • General notes

    Previously labelled as SYBL1. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224535 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Involved in the targeting and/or fusion of transport vesicles to their target membrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion. Required for calcium regulated lysosomal exocytosis. Involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi. Required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Required for focal exocytosis of late endocytic vesicles during phagosome formation.
  • Tissue specificity

    Detected in all tissues tested.
  • Sequence similarities

    Belongs to the synaptobrevin family.
    Contains 1 longin domain.
    Contains 1 v-SNARE coiled-coil homology domain.
  • Cellular localization

    Cytoplasmic vesicle > secretory vesicle membrane. Golgi apparatus > trans-Golgi network membrane. Late endosome membrane. Lysosome membrane. Endoplasmic reticulum membrane. Cytoplasmic vesicle > phagosome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ53045 antibody
    • FLJ53762 antibody
    • FLJ54296 antibody
    • HGNC:11486 antibody
    • OTTHUMP00000024258 antibody
    • OTTHUMP00000024259 antibody
    • OTTHUMP00000225953 antibody
    • SYBL 1 antibody
    • SYBL1 antibody
    • Synaptobrevin like 1 antibody
    • Synaptobrevin-like protein 1 antibody
    • Tetanus insensitive VAMP antibody
    • Tetanus neurotoxin insensitive VAMP antibody
    • Tetanus-insensitive VAMP antibody
    • TI VAMP antibody
    • Ti-VAMP antibody
    • TIVAMP antibody
    • VAMP-7 antibody
    • VAMP7 antibody
    • VAMP7_HUMAN antibody
    • Vesicle-associated membrane protein 7 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for SYBL1/VAMP-7 (green) using ab224535 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human pancreas tissue stained for SYBL1/VAMP-7 using ab224535 at 1/50 dilution in immunohistochemical analysis.

References

ab224535 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224535.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up