Overview

  • Product name

  • Description

    Rabbit polyclonal to SYCE1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human SYCE1 aa 132-351.
    Sequence:

    ECKERISALNLQIEEEKNKQRQLRLAFEEQLEDLMGQHKDLWDFHMPERL AKEICALDSSKEQLLKEEKLVKATLEDVKHQLCSLCGAEGPSTLDEGLFL RSQEAAATVQLFQEEHRKAEELLAAAAQRHQQLQQKCQQQQQKRQRLKEE LEKHGMQVPAQAQSTQEEEAGPGDVASPKPLKGERPGAAHQAGPDVLIGQ EDTLHPDLSPRGFQEIKELF


    Database link: Q8N0S2-1

  • Positive control

    • WB: Mouse liver tissue. IHC-P: Human ovarian cancer and testis tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab230095 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 40 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Requires SYCP1 in order to be incorporated into the central element. May have a role in the synaptonemal complexe assembly, stabilization and recombination.
  • Sequence similarities

    Belongs to the SYCE family.
  • Cellular localization

    Nucleus. Chromosome. Associates with chromatin. In prophase I stage of meiosis, localizes in the transverse central elements of the central region between lateral elements of the synaptonemal complexes. Found only where the chromosome cores are synapsed. Colocalizes with SYCE2 in the central elements.
  • Information by UniProt
  • Database links

  • Alternative names

    • bA108K14.6 antibody
    • C10orf94 antibody
    • Cancer/testis antigen 76 antibody
    • CT76 antibody
    • RP11-108K14.6 antibody
    • Syce1 antibody
    • SYCE1_HUMAN antibody
    • Synaptonemal complex central element protein 1 antibody
    see all

Images

  • Anti-SYCE1 antibody (ab230095) at 1/1000 dilution + Mouse liver lysate

    Secondary
    Goat polyclonal to rabbit at 1/10000 dilution

    Predicted band size: 40 kDa

  • Paraffin-embedded human ovarian cancer tissue stained for SYCE1 using ab230095 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for SYCE1 using ab230095 at 1/100 dilution in immunohistochemical analysis.

References

ab230095 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230095.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up