Overview

  • Product name

    Anti-SYCE2 antibody
  • Description

    Rabbit polyclonal to SYCE2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SYCE2 aa 136-190.
    Sequence:

    MAKISHLETELKQVCHSVETVYKDLCLQPEQSLRLRWGPDHSRGKSPPRP GNSQP


    Database link: Q6PIF2

  • Positive control

    • ICC/IF: SiHa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222314 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Requires SYCP1 in order to be incorporated into the central element. May have a role in the synaptonemal complexe assembly, stabilization and recombination.
  • Sequence similarities

    Belongs to the SYCE family.
  • Cellular localization

    Nucleus. Associates with chromatin. In prophase I stage of meiosis, localizes in the transverse central elements of the central region between lateral elements of the synaptonemal complexes. Found only where the chromosome cores are synapsed. Colocalizes with SYCE1 in the central elements.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1700013H19Rik antibody
    • AA407907 antibody
    • Central element synaptonemal complex protein 1 antibody
    • CESC1 antibody
    • RGD1311867 antibody
    • Syce2 antibody
    • SYCE2_HUMAN antibody
    • Synaptonemal complex central element protein 2 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized SiHa cells stained for SYCE2 (green) using ab222314 at 4 µg/ml in ICC/IF.

References

ab222314 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222314.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up