Overview

  • Product name

    Anti-SYN5 antibody
  • Description

    Rabbit polyclonal to SYN5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment within Human SYN5 aa 307-539. The exact sequence is proprietary.
    Sequence:

    LQGADSSQTFRPKFLALKGPSFYVFSTPPVSTFDWVRAERTYHLCEVLFK VHKFWLTEDCWLQANLYLGLQDFDFEDQRPYCFSIVAGHGKSHVFNVELG SELAMWEKSFQRATFMEVQRTGSRTYMCSWQGEMLCFTVDFALGFTCFES KTKNVLWRFKFSQLKGSSDDGKTRVKLLFQNLDTKQIETKELEFQDLRAV LHCIHSFIAAKVASVDPGFMDSQSLARKYMYSS


    Database link: Q9NY99

  • Positive control

    • A549 and H1299 whole cell lysates.
  • General notes

    Previously labelled as Syntrophin gamma 2. 

     

Properties

Applications

Our Abpromise guarantee covers the use of ab183844 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/3000. Predicted molecular weight: 60 kDa.

Target

  • Function

    Adapter protein that binds to and probably organizes the subcellular localization of a variety of proteins. May link various receptors to the actin cytoskeleton and the dystrophin glycoprotein complex.
  • Tissue specificity

    Widely expressed. Strong expression in brain and testis. In CNS, it is expressed in the perikaryon and proximal portion of the neuronal processes. Strong expression in the hippocampus, neuron-rich dendate granule cells, and pyramidal cell layers. Highly expressed in neurons of the cerebral cortex. Also expressed in the cerebellar cortex, deep cerebellar nuclei, thalamus, and basal ganglia.
  • Sequence similarities

    Belongs to the syntrophin family.
    Contains 1 PDZ (DHR) domain.
    Contains 1 PH domain.
  • Domain

    The association with dystrophin or related proteins probably leaves the PDZ domain available to recruit proteins to the membrane.
  • Cellular localization

    Cell membrane > sarcolemma. Cytoplasm > cytoskeleton. In skeletal muscle, it localizes at the cytoplasmic side of the sarcolemmal membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 9530013L23 antibody
    • G2SYN antibody
    • Gamma-2-syntrophin antibody
    • Gamma2-syntrophin antibody
    • SNTG2 antibody
    • SNTG2_HUMAN antibody
    • SYN5 antibody
    • Syntrophin 5 antibody
    • Syntrophin gamma 2 antibody
    • Syntrophin-5 antibody
    see all

Images

  • All lanes : Anti-SYN5 antibody (ab183844) at 1/1000 dilution

    Lane 1 : A549 whole cell lysate
    Lane 2 : H1299 whole cell lysate

    Lysates/proteins at 30 µg per lane.

    Predicted band size: 60 kDa

References

ab183844 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab183844.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up