Overview

  • Product name

    Anti-Synaptopodin 2 antibody
    See all Synaptopodin 2 primary antibodies
  • Description

    Rabbit polyclonal to Synaptopodin 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Synaptopodin 2 aa 66-151.
    Sequence:

    YPEVIKLMESITDSLQMLIKRPSSGISEALISENENKNLEHLTHGGYVES TTLQIRPATKTQCTEFFLAPVKTEVPLAENQRSGPD


    Database link: Q9UMS6

  • Positive control

    • SH-SY5Y cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220345 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Has an actin-binding and actin-bundling activity.
  • Tissue specificity

    Skeletal muscle-specific.
  • Sequence similarities

    Belongs to the synaptopodin family.
    Contains 1 PDZ (DHR) domain.
  • Cellular localization

    Nucleus. Cytoplasm. Shuttles between the nucleus and the cytoplasm in a differentiation-dependent and stress-induced fashion. Localizes to the Z-disk in mature striated muscle. The nuclear export is XPO1-dependent (By similarity). Localized in a fiber-like pattern. partly overlapping with filamentous actin.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp686G051 antibody
    • Genethonin 2 antibody
    • Genethonin-2 antibody
    • Myopodin antibody
    • striated muscle specific antibody
    • Synaptopodin-2 antibody
    • SYNP2_HUMAN antibody
    • SYNPO 2 antibody
    • Synpo2 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized SH-SY5Y cells labeling Synaptopodin 2 with ab220345 at 4 μg/ml (green).

References

This product has been referenced in:

  • Cai X  et al. Silence of IGFBP7 suppresses apoptosis and epithelial mesenchymal transformation of high glucose induced-podocytes. Exp Ther Med 16:1095-1102 (2018). Read more (PubMed: 30112052) »
  • Li Y  et al. Overexpression of KLF5 inhibits puromycin-induced apoptosis of podocytes. Mol Med Rep 18:3843-3849 (2018). Read more (PubMed: 30106142) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220345.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up