Overview

  • Product name

    Anti-Synaptopodin antibody
    See all Synaptopodin primary antibodies
  • Description

    Rabbit polyclonal to Synaptopodin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Synaptopodin aa 460-548.
    Sequence:

    TTPTKVYSEVHFTLAKPPSVVNRTARPFGIQAPGGTSQMERSPMLERRHF GEKAPAPQPPSLPDRSPRPQRHIMSRSPMVERRMMGQRS


    Database link: Q8N3V7

  • Positive control

    • WB: Human skeletal muscle tissue lysate. IHC-P: Human kidney, cerebral cortex and skeletal muscle tissues. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224491 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 99 kDa.
IHC-P 1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Actin-associated protein that may play a role in modulating actin-based shape and motility of dendritic spines and renal podocyte foot processes. Seems to be essential for the formation of spine apparatuses in spines of telencephalic neurons, which is involved in synaptic plasticity.
  • Tissue specificity

    Expressed in cerebral cortex.
  • Sequence similarities

    Belongs to the synaptopodin family.
  • Post-translational
    modifications

    O-glycosylated.
    Isoform 2 is phosphorylated on Ser-826, Thr-836, Ser-840 and Ser-871.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cell junction > tight junction. Perikaryon. Cell projection > dendritic spine. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Cell junction > synapse. Localized at the tight junction of cells. In brain, localized to the postsynaptic densities and in the perikarya. Asssociated with dendritic spines of a subset of synapses.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA1029 antibody
    • Synaptopodin antibody
    • SYNPO antibody
    • SYNPO_HUMAN antibody

Images

  • Paraffin-embedded human kidney tissue stained for Synaptopodin using ab224491 at 1/2500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human cerebral cortex tissue stained for Synaptopodin using ab224491 at 1/2500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skeletal muscle tissue stained for Synaptopodin using ab224491 at 1/2500 dilution in immunohistochemical analysis.

  • Negative control: Paraffin-embedded human tonsil tissue stained for Synaptopodin using ab224491 at 1/2500 dilution in immunohistochemical analysis.

  • Anti-Synaptopodin antibody (ab224491) at 1/100 dilution + Human skeletal muscle tissue lysate

    Developed using the ECL technique.

    Predicted band size: 99 kDa

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for Synaptopodin (green) using ab224491 at 4 µg/ml in ICC/IF.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (Kidney)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: ab64236 100x Citrate Buffer pH 6.0
Permeabilization
Yes - 0.05% Tween 20
Specification
Kidney
Blocking step
sea block as blocking agent for 30 minute(s) · Concentration: 100% · Temperature: 22°C
Fixative
Formaldehyde

Mr. David Ivancic

Verified customer

Submitted Jul 24 2019

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (kidney, podocyte)
Permeabilization
Yes - 1% triton
Specification
kidney, podocyte
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 2.5% · Temperature: 23°C
Fixative
Paraformaldehyde

Miss. Kara Shumansky

Verified customer

Submitted Apr 30 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up