Anti-Synaptotagmin VII antibody [N275/14] (ab174633)

Overview

  • Product name
    Anti-Synaptotagmin VII antibody [N275/14]
    See all Synaptotagmin VII primary antibodies
  • Description
    Mouse monoclonal [N275/14] to Synaptotagmin VII
  • Host species
    Mouse
  • Tested applications
    Suitable for: IHC-P, IHC-Fr, ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Fusion protein corresponding to Mouse Synaptotagmin VII aa 150-239 (internal sequence).
    Sequence:

    STLTVKVMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPH WNETFLFEGFPYEKVVQRVLYLQVLDYDRFSRNDPIGEVS


    Database link: Q9R0N7

  • Epitope
    Cytoplasmic C2A domain
  • Positive control
    • WB: Rat brain lysate.
  • General notes

    Abcam is committed to ensuring that our customers have access to all of the information we have on our products and that the product information is accurate. The clone name for this product was previously known as S27514. However, it has come to our attention that the original and primary clone name is N275/14 so we have therefore changed the product name accordingly.

     

Properties

Applications

Our Abpromise guarantee covers the use of ab174633 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
IHC-Fr Use at an assay dependent concentration.
ICC/IF 1/100.
WB 1/1000. Predicted molecular weight: 45 kDa.

Target

  • Function
    May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis.
  • Tissue specificity
    Expressed in a variety of adult and fetal tissues.
  • Sequence similarities
    Belongs to the synaptotagmin family.
    Contains 2 C2 domains.
  • Domain
    The second C2 domain/C2B is responsible for SYNCRIP binding.
  • Cellular localization
    Cytoplasmic vesicle > secretory vesicle > synaptic vesicle membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • IPCA 7 antibody
    • IPCA-7 antibody
    • IPCA7 antibody
    • PCANAP7 antibody
    • prostate cancer associated protein 7 antibody
    • Prostate cancer-associated protein 7 antibody
    • Synaptotagmin VII antibody
    • Synaptotagmin-7 antibody
    • Synaptotagmin7 antibody
    • SynaptotagminVII antibody
    • Synatotagmin 7 antibody
    • SYT 7 antibody
    • SYT VII antibody
    • SYT7 antibody
    • SYT7_HUMAN antibody
    • SytVII antibody
    see all

Images

  • Lane 1 : Anti-Synaptotagmin VII antibody [N275/14] (ab174633) at 1/100 dilution
    Lane 2 : Anti-Synaptotagmin VII antibody [N275/14] (ab174633) at 1/250 dilution
    Lane 3 : Anti-Synaptotagmin VII antibody [N275/14] (ab174633) at 1/500 dilution
    Lane 4 : Anti-Synaptotagmin VII antibody [N275/14] (ab174633) at 1/1000 dilution

    All lanes : Rat brain lysates

    Predicted band size: 45 kDa
    Additional bands at: 65 kDa (possible isoform)

References

ab174633 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174633.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up