Overview

  • Product name

  • Description

    Rabbit polyclonal to SYNC
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human SYNC aa 169-458. Two N-terminal tags, His-tag and GST-tag. Expressed in E.coli.
    Sequence:

    IEDLELLEGRFQQCVQAVAQLEEERDQLIHELVLLREPALQEVQQVHQDI LAAYKLHAQAELERDGLREEIRLVKQKLFKVTKECVAYQYQLECRQQDVA QFADFREVLTTRATQLSEELAQLRDAYQKQKEQLRQQLEAPPSQRDGHFL QESRRLSAQFENLMAESRQDLEEEYEPQFLRLLERKEAGTKALQRTQAEI QEMKEALRPLQAEARQLRLQNRNLEDQIALVRQKRDEEVQQYREQLEEME ERQRQLRNGVQLQQQKNKEMEQLRLSLAEELSTYKAMLLP


    Database link: Q9H7C4

  • Positive control

    • WB: Recombinant human SYNC protein; HeLa cell lysate; Mouse heart lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233403 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 55 kDa.

Target

  • Sequence similarities

    Belongs to the intermediate filament family.
  • Cellular localization

    Cytoplasm > perinuclear region. In skeletal muscle, colocalizes with DES and DTNA, and is localized at the myotendinous and neuromuscular junctions, sarcolemma and Z-lines. In myotubes, detected in a punctate cytoplasmic pattern.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1110057H03Rik antibody
    • Intermediate filament protein syncoilin antibody
    • MGC124230 antibody
    • MGC149625 antibody
    • MGC149626 antibody
    • RP23-391E6.2 antibody
    • SNIP4 antibody
    • SYNC antibody
    • SYNC1 antibody
    • SYNCI_HUMAN antibody
    • Syncoilin antibody
    • Syncoilin intermediate filament 1 antibody
    • Syncoilin-1 antibody
    see all

Images

  • Anti-SYNC antibody (ab233403) at 2 µg/ml + Recombinant human SYNC protein.

    Predicted band size: 55 kDa

  • All lanes : Anti-SYNC antibody (ab233403) at 2 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : Mouse heart tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 55 kDa

References

ab233403 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233403.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up