Overview

  • Product name

    Anti-SYNC antibody [OTI5B8]
    See all SYNC primary antibodies
  • Description

    Mouse monoclonal [OTI5B8] to SYNC
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human SYNC aa 1-482. Produced in E.coli (NP_110413).
    Sequence:

    MASPEPRRGGDGAAQAARKTRVEANSPLPKNSGSLNEAEALNPEVTLSSE GSLNLEDILYLEDTGDLDETLYVQETEKAEEALYIEEAMQPDEALHVEEP GNPEETVCVEETTEPDRIQFVEGPVEPGKPTSPEHVVYEGETVTRAEKSN PEESLRAEQSPSMEENLSIEDLELLEGRFQQCVQAVAQLEEERDQLIHEL VLLREPALQEVQQVHQDILAAYKLHAQAELERDGLREEIRLVKQKLFKVT KECVAYQYQLECRQQDVAQFADFREVLTTRATQLSEELAQLRDAYQKQKE QLRQQLEAPPSQRDGHFLQESRRLSAQFENLMAESRQDLEEEYEPQFLRL LERKEAGTKALQRTQAEIQEMKEALRPLQAEARQLRLQNRNLEDQIALVR QKRDEEVQQYREQLEEMEERQRQLRNGVQLQQQKNKEMEQLRLSLAEELS TYKAMLLPKSLEQADAPTSQAGGMETQSQGAV


    Database link: Q9H7C4

  • Positive control

    • WB: HEK-293T transfected with pCMV6-ENTRY SYNC cDNA. IHC-P: Human colon adenocarcinoma, kidney, liver, liver carcinoma, pancreas, thyroid carcinoma, endometrium, prostate and prostate carcinoma tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI5B8
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236418 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 55 kDa.
IHC-P 1/150.

Perform heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH 8.5) at 120°C for 3 minutes.

Target

  • Sequence similarities

    Belongs to the intermediate filament family.
  • Cellular localization

    Cytoplasm > perinuclear region. In skeletal muscle, colocalizes with DES and DTNA, and is localized at the myotendinous and neuromuscular junctions, sarcolemma and Z-lines. In myotubes, detected in a punctate cytoplasmic pattern.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1110057H03Rik antibody
    • Intermediate filament protein syncoilin antibody
    • MGC124230 antibody
    • MGC149625 antibody
    • MGC149626 antibody
    • RP23-391E6.2 antibody
    • SNIP4 antibody
    • SYNC antibody
    • SYNC1 antibody
    • SYNCI_HUMAN antibody
    • Syncoilin antibody
    • Syncoilin intermediate filament 1 antibody
    • Syncoilin-1 antibody
    see all

Images

  • All lanes : Anti-SYNC antibody [OTI5B8] (ab236418) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T transfected with pCMV6-ENTRY SYNC cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 55 kDa

  • Paraffin-embedded human colon adenocarcinoma tissue stained for SYNC using ab236418 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for SYNC using ab236418 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for SYNC using ab236418 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver carcinoma tissue stained for SYNC using ab236418 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreas tissue stained for SYNC using ab236418 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human thyroid carcinoma tissue stained for SYNC using ab236418 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrium tissue stained for SYNC using ab236418 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate tissue stained for SYNC using ab236418 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate carcinoma tissue stained for SYNC using ab236418 at 1/150 dilution in immunohistochemical analysis.

References

ab236418 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236418.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up