Anti-Syndecan-1 antibody [1A3H4] (ab181789)

Submit a review Submit a question References (2)

Overview

  • Product name

    Anti-Syndecan-1 antibody [1A3H4]
    See all Syndecan-1 primary antibodies

  • Description

    Mouse monoclonal [1A3H4] to Syndecan-1

  • Host species

    Mouse

  • Tested applications

    Suitable for: IHC-P, WB, ICC/IF, Flow Cytmore details

  • Species reactivity

    Reacts with: Mouse, Human

  • Immunogen

    Recombinant fragment corresponding to Human Syndecan-1 aa 28-171 (internal sequence). Expressed in E. Coli.
    Sequence:

    NLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQTPSTWKDTQLLTAIPTS PEPTGLEATA ASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQEATPRP RETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPS


    Database link: P18827

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • Human ovarian and rectum cancer tissues; HepG2 cells; MCF7, HeLa, HepG2, T47D, SW620, Jurkat and mouse NIH 3T3 cell lysates; Human Syndecan-1 recombinant protein (amino acids 28-171); HEK293 cell lysate transfected with Syndecan-1 (amino acids 28-171)-hIgGFc.

  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR214200-21 are from Tissue Culture Supernatant

Properties

Applications

Our Abpromise guarantee covers the use of ab181789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 32 kDa.
ICC/IF 1/200 - 1/1000.
Flow Cyt 1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)

    Immunohistochemical analysis of paraffin-embedded Human ovarian cancer tissue labeling Syndecan-1 with ab181789 at 1/200 dilution followed by DAB staining.

  • Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Anti-Syndecan-1 antibody [1A3H4] (ab181789) at 1/500 dilution + Human Syndecan-1 recombinant protein (amino acids 28-171)

    Predicted band size: 32 kDa

  • Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    All lanes : Anti-Syndecan-1 antibody [1A3H4] (ab181789) at 1/500 dilution

    Lane 1 : HEK293 cell lysate, non-transfected
    Lane 2 : HEK293 cell lysate, transfected with Syndecan-1 (amino acids 28-171)-hIgGFc

    Predicted band size: 32 kDa

  • Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    All lanes : Anti-Syndecan-1 antibody [1A3H4] (ab181789) at 1/500 dilution

    Lane 1 : MCF7 cell lysate
    Lane 2 : HeLa cell lysate
    Lane 3 : HepG2 cell lysate
    Lane 4 : T47D cell lysate
    Lane 5 : SW620 cell lysate
    Lane 6 : Jurkat cell lysate
    Lane 7 : mouse NIH 3T3 cell lysate

    Predicted band size: 32 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Immunocytochemistry/ Immunofluorescence - Anti-Syndecan-1 antibody [1A3H4] (ab181789)

    Immunofluorescent analysis of HepG2 cells labeling Syndecan-1 with ab181789 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye.

  • Flow Cytometry - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Flow Cytometry - Anti-Syndecan-1 antibody [1A3H4] (ab181789)

    Flow cytometric analysis of HepG2 cells labeling Syndecan-1 with ab181789 at 1/200 dilution (green); negative control (red).

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)

    Immunohistochemical analysis of paraffin-embedded Human rectum cancer tissue labeling Syndecan-1 with ab181789 at 1/200 dilution followed by DAB staining.

References

This product has been referenced in:

  • Gong J  et al. Long non-coding RNA CASC2 suppresses pulmonary artery smooth muscle cell proliferation and phenotypic switch in hypoxia-induced pulmonary hypertension. Respir Res 20:53 (2019). Read more (PubMed: 30857524) »
  • Liu S  et al. Knockdown of pleiotrophin increases the risk of preeclampsia following vitrified-thawed embryo transfer. Int J Oncol 53:1847-1856 (2018). Read more (PubMed: 30226583) »
See all 2 Publications for this product

Publishing research using ab181789? Please let us know so that we can cite the reference in this datasheet.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab181789.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up