Anti-Syndecan-1 antibody [1A3H4] (ab181789)
Key features and details
- Mouse monoclonal [1A3H4] to Syndecan-1
- Suitable for: IHC-P, WB, ICC/IF, Flow Cyt
- Reacts with: Mouse, Human
- Isotype: IgG1
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
Anti-Syndecan-1 antibody [1A3H4]
See all Syndecan-1 primary antibodies -
Description
Mouse monoclonal [1A3H4] to Syndecan-1 -
Host species
Mouse -
Tested applications
Suitable for: IHC-P, WB, ICC/IF, Flow Cytmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant fragment corresponding to Human Syndecan-1 aa 28-171 (internal sequence). Expressed in E. Coli.
Sequence:NLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQTPSTWKDTQLLTAIPTS PEPTGLEATA ASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQEATPRP RETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPS
Database link: P18827 -
Positive control
- Human ovarian and rectum cancer tissues; HepG2 cells; MCF7, HeLa, HepG2, T47D, SW620, Jurkat and mouse NIH 3T3 cell lysates; Human Syndecan-1 recombinant protein (amino acids 28-171); HEK293 cell lysate transfected with Syndecan-1 (amino acids 28-171)-hIgGFc.
-
General notes
This product was changed from ascites to supernatant. Lot no’s high than GR214200-21 are from Tissue Culture Supernatant
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
1A3H4 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Conjugation kits
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab181789 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/200 - 1/1000.
|
|
WB |
1/500 - 1/2000. Predicted molecular weight: 32 kDa.
|
|
ICC/IF |
1/200 - 1/1000.
|
|
Flow Cyt |
1/200 - 1/400.
ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.
|
Notes |
---|
IHC-P
1/200 - 1/1000. |
WB
1/500 - 1/2000. Predicted molecular weight: 32 kDa. |
ICC/IF
1/200 - 1/1000. |
Flow Cyt
1/200 - 1/400. ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.
|
Target
-
Function
Cell surface proteoglycan that bears both heparan sulfate and chondroitin sulfate and that links the cytoskeleton to the interstitial matrix. -
Sequence similarities
Belongs to the syndecan proteoglycan family. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 6382 Human
- Entrez Gene: 20969 Mouse
- Omim: 186355 Human
- SwissProt: P18827 Human
- SwissProt: P18828 Mouse
- Unigene: 224607 Human
- Unigene: 665958 Human
- Unigene: 2580 Mouse
-
Alternative names
- CD_antigen antibody
- CD138 antibody
- CD138 antigen antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
Immunohistochemical analysis of paraffin-embedded Human ovarian cancer tissue labeling Syndecan-1 with ab181789 at 1/200 dilution followed by DAB staining.
-
Anti-Syndecan-1 antibody [1A3H4] (ab181789) at 1/500 dilution + Human Syndecan-1 recombinant protein (amino acids 28-171)
Predicted band size: 32 kDa -
All lanes : Anti-Syndecan-1 antibody [1A3H4] (ab181789) at 1/500 dilution
Lane 1 : HEK293 cell lysate, non-transfected
Lane 2 : HEK293 cell lysate, transfected with Syndecan-1 (amino acids 28-171)-hIgGFc
Predicted band size: 32 kDa -
All lanes : Anti-Syndecan-1 antibody [1A3H4] (ab181789) at 1/500 dilution
Lane 1 : MCF7 cell lysate
Lane 2 : HeLa cell lysate
Lane 3 : HepG2 cell lysate
Lane 4 : T47D cell lysate
Lane 5 : SW620 cell lysate
Lane 6 : Jurkat cell lysate
Lane 7 : mouse NIH 3T3 cell lysate
Predicted band size: 32 kDa -
Immunofluorescent analysis of HepG2 cells labeling Syndecan-1 with ab181789 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye.
-
Flow cytometric analysis of HepG2 cells labeling Syndecan-1 with ab181789 at 1/200 dilution (green); negative control (red).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
Immunohistochemical analysis of paraffin-embedded Human rectum cancer tissue labeling Syndecan-1 with ab181789 at 1/200 dilution followed by DAB staining.
Protocols
Datasheets and documents
-
Datasheet download
References (4)
ab181789 has been referenced in 4 publications.
- Lin X et al. Follicular Helper T Cells Remodel the Immune Microenvironment of Pancreatic Cancer via Secreting CXCL13 and IL-21. Cancers (Basel) 13:N/A (2021). PubMed: 34359579
- Kang D et al. Sulfated syndecan 1 is critical to preventing cellular senescence by modulating fibroblast growth factor receptor endocytosis. FASEB J 34:10316-10328 (2020). PubMed: 32530114
- Gong J et al. Long non-coding RNA CASC2 suppresses pulmonary artery smooth muscle cell proliferation and phenotypic switch in hypoxia-induced pulmonary hypertension. Respir Res 20:53 (2019). PubMed: 30857524
- Liu S et al. Knockdown of pleiotrophin increases the risk of preeclampsia following vitrified-thawed embryo transfer. Int J Oncol 53:1847-1856 (2018). PubMed: 30226583