Anti-Syndecan-1 antibody [1A3H4] (ab181789)

Submit a review Submit a question References (2)

Key features and details

  • Mouse monoclonal [1A3H4] to Syndecan-1
  • Suitable for: IHC-P, WB, ICC/IF, Flow Cyt
  • Reacts with: Mouse, Human
  • Isotype: IgG1

Overview

  • Product name

    Anti-Syndecan-1 antibody [1A3H4]
    See all Syndecan-1 primary antibodies

  • Description

    Mouse monoclonal [1A3H4] to Syndecan-1

  • Host species

    Mouse

  • Tested applications

    Suitable for: IHC-P, WB, ICC/IF, Flow Cytmore details

  • Species reactivity

    Reacts with: Mouse, Human

  • Immunogen

    Recombinant fragment corresponding to Human Syndecan-1 aa 28-171 (internal sequence). Expressed in E. Coli.
    Sequence:

    NLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQTPSTWKDTQLLTAIPTS PEPTGLEATA ASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQEATPRP RETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPS


    Database link: P18827

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • Human ovarian and rectum cancer tissues; HepG2 cells; MCF7, HeLa, HepG2, T47D, SW620, Jurkat and mouse NIH 3T3 cell lysates; Human Syndecan-1 recombinant protein (amino acids 28-171); HEK293 cell lysate transfected with Syndecan-1 (amino acids 28-171)-hIgGFc.

  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR214200-21 are from Tissue Culture Supernatant

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

Applications

Our Abpromise guarantee covers the use of ab181789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 32 kDa.
ICC/IF 1/200 - 1/1000.
Flow Cyt 1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)

    Immunohistochemical analysis of paraffin-embedded Human ovarian cancer tissue labeling Syndecan-1 with ab181789 at 1/200 dilution followed by DAB staining.

  • Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Anti-Syndecan-1 antibody [1A3H4] (ab181789) at 1/500 dilution + Human Syndecan-1 recombinant protein (amino acids 28-171)

    Predicted band size: 32 kDa

  • Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    All lanes : Anti-Syndecan-1 antibody [1A3H4] (ab181789) at 1/500 dilution

    Lane 1 : HEK293 cell lysate, non-transfected
    Lane 2 : HEK293 cell lysate, transfected with Syndecan-1 (amino acids 28-171)-hIgGFc

    Predicted band size: 32 kDa

  • Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    All lanes : Anti-Syndecan-1 antibody [1A3H4] (ab181789) at 1/500 dilution

    Lane 1 : MCF7 cell lysate
    Lane 2 : HeLa cell lysate
    Lane 3 : HepG2 cell lysate
    Lane 4 : T47D cell lysate
    Lane 5 : SW620 cell lysate
    Lane 6 : Jurkat cell lysate
    Lane 7 : mouse NIH 3T3 cell lysate

    Predicted band size: 32 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Immunocytochemistry/ Immunofluorescence - Anti-Syndecan-1 antibody [1A3H4] (ab181789)

    Immunofluorescent analysis of HepG2 cells labeling Syndecan-1 with ab181789 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye.

  • Flow Cytometry - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Flow Cytometry - Anti-Syndecan-1 antibody [1A3H4] (ab181789)

    Flow cytometric analysis of HepG2 cells labeling Syndecan-1 with ab181789 at 1/200 dilution (green); negative control (red).

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)

    Immunohistochemical analysis of paraffin-embedded Human rectum cancer tissue labeling Syndecan-1 with ab181789 at 1/200 dilution followed by DAB staining.

References (2)

Publishing research using ab181789? Please let us know so that we can cite the reference in this datasheet.

ab181789 has been referenced in 2 publications.

  • Gong J  et al. Long non-coding RNA CASC2 suppresses pulmonary artery smooth muscle cell proliferation and phenotypic switch in hypoxia-induced pulmonary hypertension. Respir Res 20:53 (2019). PubMed: 30857524
  • Liu S  et al. Knockdown of pleiotrophin increases the risk of preeclampsia following vitrified-thawed embryo transfer. Int J Oncol 53:1847-1856 (2018). PubMed: 30226583

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab181789.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com