For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    syndecan-1-antibody-1a3h4-ab181789.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Cell Adhesion Proteins Membrane Proteins
Share by email

Anti-Syndecan-1 antibody [1A3H4] (ab181789)

  • Datasheet
Submit a review Submit a question References (4)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
  • Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
  • Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
  • Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
  • Immunocytochemistry/ Immunofluorescence - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
  • Flow Cytometry - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)

Key features and details

  • Mouse monoclonal [1A3H4] to Syndecan-1
  • Suitable for: IHC-P, WB, ICC/IF, Flow Cyt
  • Reacts with: Mouse, Human
  • Isotype: IgG1

Get better batch-to-batch reproducibility with a recombinant antibody

Product image
Anti-Syndecan-1 antibody [EPR6454] (ab128936)
  • Research with confidence – consistent and reproducible results with every batch
  • Long-term and scalable supply – powered by recombinant technology for fast production
  • Success from the first experiment – confirmed specificity through extensive validation
  • Ethical standards compliant – production is animal-free

Overview

  • Product name

    Anti-Syndecan-1 antibody [1A3H4]
    See all Syndecan-1 primary antibodies
  • Description

    Mouse monoclonal [1A3H4] to Syndecan-1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IF, Flow Cytmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human Syndecan-1 aa 28-171 (internal sequence). Expressed in E. Coli.
    Sequence:

    NLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQTPSTWKDTQLLTAIPTS PEPTGLEATA ASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQEATPRP RETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPS


    Database link: P18827
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Human ovarian and rectum cancer tissues; HepG2 cells; MCF7, HeLa, HepG2, T47D, SW620, Jurkat and mouse NIH 3T3 cell lysates; Human Syndecan-1 recombinant protein (amino acids 28-171); HEK293 cell lysate transfected with Syndecan-1 (amino acids 28-171)-hIgGFc.
  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR214200-21 are from Tissue Culture Supernatant

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    1A3H4
  • Isotype

    IgG1
  • Research areas

    • Neuroscience
    • Cell Adhesion Proteins
    • Membrane Proteins
    • Neuroscience
    • Cell Adhesion Proteins
    • ECM Proteins
    • Signal Transduction
    • Cytoskeleton / ECM
    • Extracellular Matrix
    • ECM Proteins
    • Glucosaminoglycans
    • Neuroscience
    • Cell Type Marker
    • Neuron marker
    • Synapse marker
    • Neuroscience
    • Neurology process
    • Neurogenesis
    • Signal Transduction
    • Cytoskeleton / ECM
    • HSPGs
    • Cancer
    • Invasion/microenvironment
    • ECM
    • Extracellular matrix
    • Other
    • Stem Cells
    • Hematopoietic Progenitors
    • Lymphoid
    • B Lymphocytic Lineage
    • Cancer
    • Cancer Metabolism
    • Metabolic signaling pathway
    • Metabolism of lipids and lipoproteins
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Lipid and lipoprotein metabolism
    • Lipid metabolism

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Conjugation kits

    • PE / R-Phycoerythrin Conjugation Kit - Lightning-Link® (ab102918)
    • APC Conjugation Kit - Lightning-Link® (ab201807)
  • Isotype control

    • Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)
  • Positive Controls

    • T-47D whole cell lysate (ab14899)
    • HeLa whole cell lysate (ab150035)
    • Hep G2 whole cell lysate (ab166833)
    • HeLa whole cell lysate (ab29545)
    • NIH/3T3 whole cell lysate (ab7179)
    • Jurkat whole cell lysate (ab7899)
  • Recombinant Protein

    • Recombinant Human Syndecan-1 protein (His tag) (ab124600)
  • Related Products

    • Recombinant Human Syndecan-1 protein (His tag) (ab124600)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab181789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P
1/200 - 1/1000.
WB
1/500 - 1/2000. Predicted molecular weight: 32 kDa.
ICC/IF
1/200 - 1/1000.
Flow Cyt
1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Notes
IHC-P
1/200 - 1/1000.
WB
1/500 - 1/2000. Predicted molecular weight: 32 kDa.
ICC/IF
1/200 - 1/1000.
Flow Cyt
1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

  • Function

    Cell surface proteoglycan that bears both heparan sulfate and chondroitin sulfate and that links the cytoskeleton to the interstitial matrix.
  • Sequence similarities

    Belongs to the syndecan proteoglycan family.
  • Cellular localization

    Membrane.
  • Target information above from: UniProt accession P18827 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 6382 Human
    • Entrez Gene: 20969 Mouse
    • Omim: 186355 Human
    • SwissProt: P18827 Human
    • SwissProt: P18828 Mouse
    • Unigene: 224607 Human
    • Unigene: 665958 Human
    • Unigene: 2580 Mouse
    • Alternative names

      • CD_antigen antibody
      • CD138 antibody
      • CD138 antigen antibody
      • heparan sulfate proteoglycan fibroblast growth factor receptor antibody
      • SDC antibody
      • Sdc1 antibody
      • SDC1_HUMAN antibody
      • SYND1 antibody
      • Syndecan 1 antibody
      • Syndecan antibody
      • syndecan proteoglycan 1 antibody
      • Syndecan-1 antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)

      Immunohistochemical analysis of paraffin-embedded Human ovarian cancer tissue labeling Syndecan-1 with ab181789 at 1/200 dilution followed by DAB staining.

    • Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
      Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
      Anti-Syndecan-1 antibody [1A3H4] (ab181789) at 1/500 dilution + Human Syndecan-1 recombinant protein (amino acids 28-171)

      Predicted band size: 32 kDa

    • Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
      Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
      All lanes : Anti-Syndecan-1 antibody [1A3H4] (ab181789) at 1/500 dilution

      Lane 1 : HEK293 cell lysate, non-transfected
      Lane 2 : HEK293 cell lysate, transfected with Syndecan-1 (amino acids 28-171)-hIgGFc

      Predicted band size: 32 kDa

    • Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
      Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
      All lanes : Anti-Syndecan-1 antibody [1A3H4] (ab181789) at 1/500 dilution

      Lane 1 : MCF7 cell lysate
      Lane 2 : HeLa cell lysate
      Lane 3 : HepG2 cell lysate
      Lane 4 : T47D cell lysate
      Lane 5 : SW620 cell lysate
      Lane 6 : Jurkat cell lysate
      Lane 7 : mouse NIH 3T3 cell lysate

      Predicted band size: 32 kDa

    • Immunocytochemistry/ Immunofluorescence - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
      Immunocytochemistry/ Immunofluorescence - Anti-Syndecan-1 antibody [1A3H4] (ab181789)

      Immunofluorescent analysis of HepG2 cells labeling Syndecan-1 with ab181789 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye.

    • Flow Cytometry - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
      Flow Cytometry - Anti-Syndecan-1 antibody [1A3H4] (ab181789)

      Flow cytometric analysis of HepG2 cells labeling Syndecan-1 with ab181789 at 1/200 dilution (green); negative control (red).

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)

      Immunohistochemical analysis of paraffin-embedded Human rectum cancer tissue labeling Syndecan-1 with ab181789 at 1/200 dilution followed by DAB staining.

    Protocols

    • Flow cytometry protocols
    • Immunohistochemistry protocols
    • Immunocytochemistry & immunofluorescence protocols
    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet download

      Download

    References (4)

    Publishing research using ab181789? Please let us know so that we can cite the reference in this datasheet.

    ab181789 has been referenced in 4 publications.

    • Lin X  et al. Follicular Helper T Cells Remodel the Immune Microenvironment of Pancreatic Cancer via Secreting CXCL13 and IL-21. Cancers (Basel) 13:N/A (2021). PubMed: 34359579
    • Kang D  et al. Sulfated syndecan 1 is critical to preventing cellular senescence by modulating fibroblast growth factor receptor endocytosis. FASEB J 34:10316-10328 (2020). PubMed: 32530114
    • Gong J  et al. Long non-coding RNA CASC2 suppresses pulmonary artery smooth muscle cell proliferation and phenotypic switch in hypoxia-induced pulmonary hypertension. Respir Res 20:53 (2019). PubMed: 30857524
    • Liu S  et al. Knockdown of pleiotrophin increases the risk of preeclampsia following vitrified-thawed embryo transfer. Int J Oncol 53:1847-1856 (2018). PubMed: 30226583

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab181789.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2022 Abcam plc. All rights reserved.