Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online

Anti-Syndecan-1 antibody [1A3H4] (ab181789)

Submit a review Submit a question References (4)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
  • Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
  • Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
  • Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
  • Immunocytochemistry/ Immunofluorescence - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
  • Flow Cytometry - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)

Key features and details

  • Mouse monoclonal [1A3H4] to Syndecan-1
  • Suitable for: IHC-P, WB, ICC/IF, Flow Cyt
  • Reacts with: Mouse, Human
  • Isotype: IgG1

Get better batch-to-batch reproducibility with a recombinant antibody

Product image
Anti-Syndecan-1 antibody [EPR6454] (ab128936)
  • Research with confidence – consistent and reproducible results with every batch
  • Long-term and scalable supply – powered by recombinant technology for fast production
  • Success from the first experiment – confirmed specificity through extensive validation
  • Ethical standards compliant – production is animal-free

Overview

  • Product name

    Anti-Syndecan-1 antibody [1A3H4]
    See all Syndecan-1 primary antibodies

  • Description

    Mouse monoclonal [1A3H4] to Syndecan-1

  • Host species

    Mouse

  • Tested applications

    Suitable for: IHC-P, WB, ICC/IF, Flow Cytmore details

  • Species reactivity

    Reacts with: Mouse, Human

  • Immunogen

    Recombinant fragment corresponding to Human Syndecan-1 aa 28-171 (internal sequence). Expressed in E. Coli.
    Sequence:

    NLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQTPSTWKDTQLLTAIPTS PEPTGLEATA ASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQEATPRP RETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPS


    Database link: P18827
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • Human ovarian and rectum cancer tissues; HepG2 cells; MCF7, HeLa, HepG2, T47D, SW620, Jurkat and mouse NIH 3T3 cell lysates; Human Syndecan-1 recombinant protein (amino acids 28-171); HEK293 cell lysate transfected with Syndecan-1 (amino acids 28-171)-hIgGFc.

  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR214200-21 are from Tissue Culture Supernatant

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab181789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P
1/200 - 1/1000.
WB
1/500 - 1/2000. Predicted molecular weight: 32 kDa.
ICC/IF
1/200 - 1/1000.
Flow Cyt
1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 
Notes
IHC-P
1/200 - 1/1000.
WB
1/500 - 1/2000. Predicted molecular weight: 32 kDa.
ICC/IF
1/200 - 1/1000.
Flow Cyt
1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)

    Immunohistochemical analysis of paraffin-embedded Human ovarian cancer tissue labeling Syndecan-1 with ab181789 at 1/200 dilution followed by DAB staining.

  • Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Anti-Syndecan-1 antibody [1A3H4] (ab181789) at 1/500 dilution + Human Syndecan-1 recombinant protein (amino acids 28-171)

    Predicted band size: 32 kDa

  • Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    All lanes : Anti-Syndecan-1 antibody [1A3H4] (ab181789) at 1/500 dilution

    Lane 1 : HEK293 cell lysate, non-transfected
    Lane 2 : HEK293 cell lysate, transfected with Syndecan-1 (amino acids 28-171)-hIgGFc

    Predicted band size: 32 kDa

  • Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Western blot - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    All lanes : Anti-Syndecan-1 antibody [1A3H4] (ab181789) at 1/500 dilution

    Lane 1 : MCF7 cell lysate
    Lane 2 : HeLa cell lysate
    Lane 3 : HepG2 cell lysate
    Lane 4 : T47D cell lysate
    Lane 5 : SW620 cell lysate
    Lane 6 : Jurkat cell lysate
    Lane 7 : mouse NIH 3T3 cell lysate

    Predicted band size: 32 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Immunocytochemistry/ Immunofluorescence - Anti-Syndecan-1 antibody [1A3H4] (ab181789)

    Immunofluorescent analysis of HepG2 cells labeling Syndecan-1 with ab181789 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye.

  • Flow Cytometry - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Flow Cytometry - Anti-Syndecan-1 antibody [1A3H4] (ab181789)

    Flow cytometric analysis of HepG2 cells labeling Syndecan-1 with ab181789 at 1/200 dilution (green); negative control (red).

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)

    Immunohistochemical analysis of paraffin-embedded Human rectum cancer tissue labeling Syndecan-1 with ab181789 at 1/200 dilution followed by DAB staining.

References (4)

Publishing research using ab181789? Please let us know so that we can cite the reference in this datasheet.

ab181789 has been referenced in 4 publications.

  • Lin X  et al. Follicular Helper T Cells Remodel the Immune Microenvironment of Pancreatic Cancer via Secreting CXCL13 and IL-21. Cancers (Basel) 13:N/A (2021). PubMed: 34359579
  • Kang D  et al. Sulfated syndecan 1 is critical to preventing cellular senescence by modulating fibroblast growth factor receptor endocytosis. FASEB J 34:10316-10328 (2020). PubMed: 32530114
  • Gong J  et al. Long non-coding RNA CASC2 suppresses pulmonary artery smooth muscle cell proliferation and phenotypic switch in hypoxia-induced pulmonary hypertension. Respir Res 20:53 (2019). PubMed: 30857524
  • Liu S  et al. Knockdown of pleiotrophin increases the risk of preeclampsia following vitrified-thawed embryo transfer. Int J Oncol 53:1847-1856 (2018). PubMed: 30226583

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab181789.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com