Overview

  • Product name

  • Description

    Rabbit polyclonal to Syndecan-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Syndecan-1 aa 18-218. (NP_002988.3)
    Sequence:

    QPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQTPSTWKD TQLLTAIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAR EQEATPRPRETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTP AGPSQADLHTPHTEDGGPSATERAAEDGASSQLPAAEGSGEQDFTFETSG E


    Database link: P18827

  • Positive control

    • Human prostate, skin, placenta and kidney tissue.

Applications

Our Abpromise guarantee covers the use of ab188861 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 15 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Cell surface proteoglycan that bears both heparan sulfate and chondroitin sulfate and that links the cytoskeleton to the interstitial matrix.
  • Sequence similarities

    Belongs to the syndecan proteoglycan family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD_antigen antibody
    • CD138 antibody
    • CD138 antigen antibody
    • heparan sulfate proteoglycan fibroblast growth factor receptor antibody
    • SDC antibody
    • Sdc1 antibody
    • SDC1_HUMAN antibody
    • SYND1 antibody
    • Syndecan 1 antibody
    • Syndecan antibody
    • syndecan proteoglycan 1 antibody
    • Syndecan-1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human skin tissue labeling Syndecan-1 with ab188861 at 15 µg/ml

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human placenta labeling Syndecan-1 with ab188861 at 15 µg/ml

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human kidney tissue labeling Syndecan-1 with ab188861 at 15 µg/ml

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human prostate tissue labeling Syndecan-1 with ab188861 at 15 µg/ml

References

ab188861 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188861.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up