Overview

  • Product name

  • Description

    Rabbit polyclonal to Syndecan-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Syndecan-1 aa 23-254.
    Sequence:

    QIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQTPSTWKDTQLLT AIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQEAT PRPRETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPSQ ADLHTPHTEDGGPSATERAAEDGASSQLPAAEGSGEQDFTFETSGENTAV VAVEPDRRNQSPVDQGATGASQGLLDRKEVLG


    Database link: P18827

  • Positive control

    • IHC-P: Human rectum tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab235921 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Cell surface proteoglycan that bears both heparan sulfate and chondroitin sulfate and that links the cytoskeleton to the interstitial matrix.
  • Sequence similarities

    Belongs to the syndecan proteoglycan family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD_antigen antibody
    • CD138 antibody
    • CD138 antigen antibody
    • heparan sulfate proteoglycan fibroblast growth factor receptor antibody
    • SDC antibody
    • Sdc1 antibody
    • SDC1_HUMAN antibody
    • SYND1 antibody
    • Syndecan 1 antibody
    • Syndecan antibody
    • syndecan proteoglycan 1 antibody
    • Syndecan-1 antibody
    see all

Images

  • Paraffin-embedded human rectum tissue stained for Syndecan-1 using ab235921 at 1/100 dilution in immunohistochemical analysis.

  • 4% formaldehyde-fixed, 0.2% Triton X-100 permeabilized HepG2 (human liver hepatocellular carcinoma cell line) cells stained for Syndecan-1 (green) using ab235921 at 1/145 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-conjugated AffiniPure Goat Anti-Rabbit IgG (H+L). Counter stained with DAPI.

References

ab235921 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235921.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up