Overview

  • Product name

    Anti-SYNJ2BP antibody - N-terminal
  • Description

    Rabbit polyclonal to SYNJ2BP - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human SYNJ2BP aa 2-113 (N terminal).
    Sequence:

    NGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENG AAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQ VQNGPIGHRGEG


    Database link: P57105

  • Positive control

    • WB: RT4 cell lysate; human and mouse cerebral cortex tissue lysates. IHC-P: Human stomach tissue; mouse hippocampus, globus pallidus and parietal association cortex tissue. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224217 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/250 - 1/500. Predicted molecular weight: 16 kDa.

Target

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for SYNJ2BP (green) using ab224217 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded mouse hippocampus tissue stained for SYNJ2BP using ab224217 at 1/500 dilution in immunohistochemical analysis using a fluorescent secondary antibody.

  • Paraffin-embedded mouse globus pallidus tissue stained for SYNJ2BP using ab224217 at 1/500 dilution in immunohistochemical analysis using a fluorescent secondary antibody.

  • Paraffin-embedded mouse parietal association cortex tissue stained for SYNJ2BP using ab224217 at 1/500 dilution in immunohistochemical analysis using a fluorescent secondary antibody.

  • Paraffin-embedded human stomach tissue stained for SYNJ2BP using ab224217 at 1/500 dilution in immunohistochemical analysis.

  • Anti-SYNJ2BP antibody - N-terminal (ab224217) at 1/250 dilution + RT4 (human urinary bladder cancer cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 16 kDa

  • Anti-SYNJ2BP antibody - N-terminal (ab224217) at 1/250 dilution + Human cerebral cortex tissue lysate

    Developed using the ECL technique.

    Predicted band size: 16 kDa

  • Anti-SYNJ2BP antibody - N-terminal (ab224217) at 1/250 dilution + Mouse cerebral cortex tissue lysate

    Developed using the ECL technique.

    Predicted band size: 16 kDa

References

ab224217 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224217.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up