Overview

  • Product name

    Anti-Syntaxin 12/Syntaxin-13 antibody
    See all Syntaxin 12/Syntaxin-13 primary antibodies
  • Description

    Rabbit polyclonal to Syntaxin 12/Syntaxin-13
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Syntaxin 12/Syntaxin-13 aa 103-186.
    Sequence:

    KERLMNDFSAALNNFQAVQRRVSEKEKESIARARAGSRLSAEERQREEQL VSFDSHEEWNQMQSQEDEVAITEQDLELIKERET


    Database link: Q86Y82

  • Positive control

    • RT-4 and U-251 MG cell line lysates; HeLa cells.
  • General notes

     This product was previously labelled as Syntaxin 12

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220746 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

WB 1/500 - 1/1000. Predicted molecular weight: 32 kDa.

Target

Images

  • All lanes : Anti-Syntaxin 12/Syntaxin-13 antibody (ab220746) at 1/500 dilution

    Lane 1 : RT-4 cell line lysate
    Lane 2 : U-251 MG cell line lysate

    Predicted band size: 32 kDa

  • Immunofluorescent analysis of PFA-fixed/Triton X-100 permeabilized HeLa cells labeling Syntaxin 12/Syntaxin-13 with ab220746 at 4 μg/ml (green).

References

ab220746 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220746.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up