Overview

  • Product name

    Anti-Syntaxin 2/STX2 antibody
    See all Syntaxin 2/STX2 primary antibodies
  • Description

    Rabbit polyclonal to Syntaxin 2/STX2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Syntaxin 2/STX2 aa 8-262. (Expressed in E.coli).
    Sequence:

    LTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNH SIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNR TSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGR TTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETS IRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQ SKARR


    Database link: P32856

  • Positive control

    • IHC-P: Human breast cancer, glioma, lung cancer, kidney, stomach and pancreas tissues. WB: Human serum, Human lung lysate; Pig brain lysate; HeLa cell lysate; Recombinant human Syntaxin 2/STX2 protein.
  • General notes

     This product was previously labelled as Syntaxin 2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    ab233275 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233275 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 33 kDa.

Target

  • Function

    Essential for epithelial morphogenesis. May mediate Ca(2+)-regulation of exocytosis acrosomal reaction in sperm.
  • Sequence similarities

    Belongs to the syntaxin family.
    Contains 1 t-SNARE coiled-coil homology domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Form

    Inhibition of syntaxin-2 and Vamp8 function by overexpression of nonmembrane-anchored mutants caused failure of cytokinesis leading to the formation of binucleated cells. There are 3 isoforms produced by alternative splicing.
  • Alternative names

    • EPIM antibody
    • Epimorphin antibody
    • EPM antibody
    • MGC51014 antibody
    • OTTHUMP00000238636 antibody
    • OTTHUMP00000238637 antibody
    • Stx2 antibody
    • STX2_HUMAN antibody
    • STX2A antibody
    • STX2B antibody
    • STX2C antibody
    • Syntaxin 2A antibody
    • Syntaxin 2B antibody
    • Syntaxin 2C antibody
    • Syntaxin-2 antibody
    see all

Images

  • All lanes : Anti-Syntaxin 2/STX2 antibody (ab233275) at 1 µg/ml

    Lane 1 : Human serum
    Lane 2 : Human lung lysate
    Lane 3 : Pig brain lysate
    Lane 4 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 33 kDa

  • Paraffin-embedded human breast cancer tissue stained for Syntaxin 2/STX2 using ab233275 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human glioma tissue stained for Syntaxin 2/STX2 using ab233275 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human lung cancer tissue stained for Syntaxin 2/STX2 using ab233275 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for Syntaxin 2/STX2 using ab233275 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human stomach tissue stained for Syntaxin 2/STX2 using ab233275 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human pancreas tissue stained for Syntaxin 2/STX2 using ab233275 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Syntaxin 2/STX2 antibody (ab233275) at 1 µg + Recombinant human Syntaxin 2/STX2 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 33 kDa

References

ab233275 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233275.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up