Anti-Syntaxin 6 antibody (ab238160)
Key features and details
- Rabbit polyclonal to Syntaxin 6
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Syntaxin 6 antibody
See all Syntaxin 6 primary antibodies -
Description
Rabbit polyclonal to Syntaxin 6 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Chicken, Orangutan -
Immunogen
Recombinant fragment corresponding to Human Syntaxin 6 aa 5-234.
Sequence:DPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNL RSIEWDLEDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKD QMSTSSVQALAERKNRQALLGDSGSQNWSTGTTDKYGRLDRELQRANSHF IEEQQAQQQLIVEQQDEQLELVSGSIGVLKNMSQRIGGELEEQAVMLEDF SHELESTQSRLDNVMKKLAKVSHMTSDRRQ
Database link: O43752 -
Positive control
- IHC-P: Human colon cancer tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab238160 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. |
Target
-
Function
Involved in intracellular vesicle trafficking. -
Sequence similarities
Belongs to the syntaxin family.
Contains 1 t-SNARE coiled-coil homology domain. -
Post-translational
modificationsPhosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Golgi apparatus membrane. - Information by UniProt
-
Database links
- Entrez Gene: 424413 Chicken
- Entrez Gene: 10228 Human
- Entrez Gene: 58244 Mouse
- Entrez Gene: 100173487 Orangutan
- Entrez Gene: 60562 Rat
- Omim: 603944 Human
- SwissProt: Q5ZL19 Chicken
- SwissProt: O43752 Human
see all -
Alternative names
- LAMB2 antibody
- LAMC1 antibody
- Laminin B2 chain antibody
see all
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab238160 has not yet been referenced specifically in any publications.