Overview

  • Product name

  • Description

    Rabbit polyclonal to Syntaxin 7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Syntaxin 7 aa 1-170.
    Sequence:

    MSYTPGVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQ QLQQKQQYTNQLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTS LTNFQKVQRQAAEREKEFVARVRASSRVSGSFPEDSSKERNLVSWESQTQ PQVQVQDEEITEDDLRLIHE


    Database link: O15400

  • Positive control

    • WB: Mouse spleen lysate; HeLa and HepG2 whole cell lysates. IHC-P: Human tonsil and small intestine tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab229746 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 30 kDa (predicted molecular weight: 30 kDa).
IHC-P 1/20 - 1/200.

Target

Images

  • All lanes : Anti-Syntaxin 7 antibody (ab229746) at 1/1000 dilution

    Lane 1 : Mouse spleen lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 30 kDa
    Observed band size: 30 kDa

  • Paraffin-embedded human tonsil tissue stained for Syntaxin 7 using ab229746 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for Syntaxin 7 using ab229746 at 1/100 dilution in immunohistochemical analysis.

References

ab229746 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229746.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up