Overview

  • Product name

    Anti-Syntaxin 7 antibody [CL0257]
    See all Syntaxin 7 primary antibodies
  • Description

    Mouse monoclonal [CL0257] to Syntaxin 7
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Syntaxin 7 aa 6-153.
    Sequence:

    GVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQK QQYTNQLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQ KVQRQAAEREKEFVARVRASSRVSGSFPEDSSKERNLVSWESQTQPQV


    Database link: O15400

  • Positive control

    • Human melanoma and lymph node tissues; human tonsil lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab211461 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of human lymph node tissue labeling Syntaxin 7 with ab211461 at 1/500 dilution.

  • Immunohistochemical analysis of human melanoma tissue labeling Syntaxin 7 with ab211461 at 1/500 dilution.

  • Immunohistochemical analysis of human melanoma tissue labeling Syntaxin 7 with ab211461 at 1/500 dilution.

  • Anti-Syntaxin 7 antibody [CL0257] (ab211461) at 1/500 dilution + human tonsil tissue lysate

References

ab211461 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211461.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up