Synthetic Human BCA1 protein (Biotin) (ab176079)

Overview

Description

  • Nature
    Synthetic
  • Source
    Synthetic
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNK SIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRK(Biotin)IP
    • Molecular weight
      11 kDa
    • Amino acids
      23 to 109
    • Additional sequence information
      Mature protein.
  • Conjugation
    Biotin

Associated products

Specifications

Our Abpromise guarantee covers the use of ab176079 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

  • Reconstitution
    It is recommended vials be centrifuged prior to opening. Water can be used to prepare stock solutions of 20 µmol.L-1. Stock solutions with up to 30% DMSO/water can also be prepared.

General Info

  • Alternative names
    • ANGIE
    • ANGIE2
    • B cell attracting chemokine 1
    • B cell-attracting chemokine 1
    • B lymphocyte chemoattractant
    • B-cell chemoattractant
    • B-cell-attracting chemokine 1
    • B-cell-homing chemokine (ligand for Burkitt's lymphoma receptor-1)
    • BCA-1
    • BLC
    • BLR1L
    • C-X-C motif chemokine 13
    • Chemokine (C-X-C motif) ligand 13
    • Chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant)
    • Chemokine, CXC motif, ligand 13
    • CXC chemokine BLC
    • CXCL13
    • CXL13_HUMAN
    • SCYB13
    • Small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant)
    • Small inducible cytokine B13
    • Small inducible cytokine subfamily B, member 13
    • Small-inducible cytokine B13
    see all
  • Function
    Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.
  • Tissue specificity
    Highest levels in liver, followed by spleen, lymph node, appendix and stomach. Low levels in salivary gland, mammary gland and fetal spleen.
  • Sequence similarities
    Belongs to the intercrine alpha (chemokine CxC) family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab176079 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176079.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up