Description

  • Product name

    Synthetic Human beta 2 Defensin/BD-2 protein
    See all beta 2 Defensin/BD-2 proteins and peptides
  • Expression system

    Synthetic
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Synthetic
    • Species

      Human
    • Sequence

      GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
    • Predicted molecular weight

      4 kDa
    • Amino acids

      24 to 64
    • Additional sequence information

      Modifications: Disulphide bridge. Sequence refers to the mature full length protein.

Specifications

Our Abpromise guarantee covers the use of ab174985 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as beta 2 Defensin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

  • Reconstitution
    It is recommended vials be centrifuged prior to opening. Water can be used to prepare stock solutions of 20 µmol.L-1. Stock solutions with up to 30% DMSO/water can also be prepared.

General Info

  • Alternative names

    • BD 2
    • BD-2
    • BD2
    • beta 2
    • beta 2 Defensin
    • Beta defensin 2
    • Beta defensin 4B
    • Beta-defensin 2
    • Beta-defensin 4A
    • DEF B2
    • DEF B4
    • DEFB 102
    • DEFB 2
    • DEFB 4
    • DEFB102
    • DEFB2
    • DEFB2, formerly
    • DEFB4
    • DEFB4, formerly
    • DEFB4B
    • DEFB4P
    • Defensin
    • Defensin beta 2
    • Defensin, beta 4
    • Defensin, beta 4, pseudogene
    • Defensin, beta 4A
    • Defensin, beta 4B
    • Defensin, beta, 2, formerly
    • Defensin, beta, 4, formerly
    • DFB4A_HUMAN
    • HBD 2
    • hBD-2
    • HBD2
    • mBD-2
    • SAP 1
    • SAP1
    • Skin antimicrobial peptide 1
    • Skin-antimicrobial peptide 1
    see all
  • Function

    Has antibacterial activity.
  • Tissue specificity

    Expressed in the skin and respiratory tract.
  • Sequence similarities

    Belongs to the beta-defensin family. LAP/TAP subfamily.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab174985 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174985.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up